On July 23, 2025, a total of 1,483 newly registered domains were recorded under the HELP TLD by ABTdomain. This volume marks a notable increase compared to recent averages, with registrations showing a wide range of domain name lengths and a clear concentration of registrations through leading registrars. The data reveals precise insights into domain length distribution, registrar shares, and registration term preferences, providing valuable information for domain investors and industry professionals focused on HELP newly registered domains.
Registration Overview
The HELP TLD saw 1,483 domains newly recorded on this day. This figure reflects the domains captured by ABTdomain on 2025-07-23, not necessarily the exact registration date, indicating active market participation within this namespace.
Domain Characteristics
The average length of the newly recorded HELP domains is 23.5 characters, with individual domain lengths ranging from a minimum of 4 characters to a maximum of 39 characters. Shorter domains like blsp.help coexist alongside much longer names such as capitalvisionplanhelpwithgainwaycapital.help.
Registrar distribution highlights Porkbun, LLC as the market leader, accounting for exactly half of all registrations with 741 domains (50.0%). This concentration emphasizes the dominant role of this registrar in HELP domain registrations.
Historical Comparison
When compared to recent activity, the newly registered HELP domains recorded today demonstrate substantial increases:
- +838.6% compared to 7 days prior
- +503.7% relative to the 10-day average
- +307.8% relative to the 30-day average
These figures reflect a marked spike in recorded HELP domain activity for the day, highlighting a temporary surge in new domain records within the TLD.
Registrar Distribution
The registrar landscape for HELP newly registered domains is dominated by two main entities:
- Porkbun, LLC – 741 domains
- Porkbun LLC – 619 domains
- NameSilo, LLC – 56 domains
Notable domain examples associated with these registrars include gainwaycapital360.help, boostgainwaycapitalvisionkit.help, and financecheckgainwaycapital.help, illustrating the breadth of domain registrations managed by these providers.
Registration Terms
Registration periods for HELP domains recorded today range from 1 to 2 years. Examples of longer-term registrations include ellmo.help, aivm.help, and globaliqx.help. This indicates a preference among some registrants for securing domains over extended periods.
Domain Usage
- 0 domains (0.0%) are currently listed for sale.
- 50 domains (3.4%) utilize Cloudflare DNS services, examples include realhuman.help and geschaftskonto.help.
- 0 domains (0.0%) use Squarespace DNS.
The absence of for-sale domains and limited DNS service adoption highlight a current stage of domain usage and development within the HELP namespace.
Conclusion
The data for HELP newly registered domains recorded on July 23, 2025, demonstrates a noteworthy spike in domain registration volume, with 1,483 domains recorded—substantially exceeding both the previous day’s count and the 10-day average. The dominance of Porkbun, LLC in registrar share and the broad range of domain name lengths reflect active domain acquisition behaviors. However, the modest percentage of domains utilizing Cloudflare DNS and the complete absence of domains listed for sale suggest that many registrations remain in early stages of deployment or use.
For domain investors and industry watchers, these findings provide a clear snapshot of HELP newly registered domains on this specific day, emphasizing volume surges without overextending into speculative interpretation. The data underscores the importance of monitoring registrar activity and domain characteristics closely to identify tangible market developments.
Related Newly Registered Domains Reports
Explore newly registered domains for key TLDs on the same date:
- Check HELP newly registered domains details on July 23, 2025, please visit: .HELP Newly Registered Domains (Current Report)
- Check COM newly registered domains details on July 23, 2025, please visit: .COM Newly Registered Domains
- Check NET newly registered domains details on July 23, 2025, please visit: .NET Newly Registered Domains
- Check ORG newly registered domains details on July 23, 2025, please visit: .ORG Newly Registered Domains
- Check XYZ newly registered domains details on July 23, 2025, please visit: .XYZ Newly Registered Domains
- Check NOW newly registered domains details on July 23, 2025, please visit: .NOW Newly Registered Domains
Related Domain Reports
- Need detailed numbers on active and newly registered domains? Check out our complete TLD Domain Report – July 23, 2025, featuring comprehensive registration statistics, trends, and analysis across all monitored TLDs.
- Dive into our analysis of newly registered domains across all monitored TLDs, explore the full report here: Newly Registered Domains Report – July 23, 2025.
- Track domain activity trends across all monitored TLDs on our ABTdomain TLDs Registrations and Newly Registered Domains Trends dashboard — updated daily to help you spot new opportunities.
- Stay ahead with our daily-updated Expired Domain Reports, featuring high-potential expiring and pending delete domains. Visit Expired Domains Report to explore new investment options.
- Want to understand how we gather and verify our data? Learn more about our TLD Report sources, methodology, and daily update process in the FAQ section.
Please respect our Terms of Service and do not abuse the data. Unauthorized bulk downloading or commercial misuse is strictly prohibited.