On September 15, 2026, ABTdomain recorded 6119 .COM domains (10+ years of registration history) entering the redemption period. This is the 30-day recovery stage in the domain lifecycle: the original registrant can still reclaim the domain during this window. Domains not recovered proceed to pending delete.
This page focuses on .COM domains. For .NET and .ORG domains, check our .NET and .ORG domains page.
Age distribution of domains recorded on this date:
- .COM Domains (30+ years): 1 domains
- .COM Domains (20-30 years): 825 domains
- .COM Domains (10-20 years): 5293 domains
The oldest domain in this snapshot is 31 years old. Registrar distribution: GoDaddy (2758), Gname.Com Pte. Ltd. (453).
Note: ABTdomain filters for domains over 10 years old. Shorter-lived domains entering redemption on the same date are not included in this report.
If a domain in this list is of particular interest, this window is the last point in the lifecycle where the original owner can recover it. After this, it enters pending delete and becomes available for re-registration.
Ultra Premium .COM Domains 30+ years
These .COM domains have been registered for over 30 years.
| Domain | Component | Registration | Expiration | Age | Registrar |
|---|---|---|---|---|---|
| starbirdinc.com | star bird inc | 1995-08-03 | 2026-08-02 | 31 | Network Solutions, Llc |
Premium .COM Domains 20-30 years
.COM domains in the 20-30 year age range.
| Domain | Component | Registration | Expiration | Age | Registrar |
|---|---|---|---|---|---|
| elecres.com | elec res | 1997-07-16 | 2027-07-15 | 30 | GoDaddy |
| mccray-inc.com | mccray inc | 1996-09-30 | 2026-08-03 | 30 | GoDaddy |
| turkeystore.com | turkey store | 1996-08-23 | 2026-08-22 | 30 | Safenames Ltd. |
| netgenics.com | net genics | 1996-08-06 | 2026-08-05 | 30 | Cloudflare, Inc. |
| minerve.com | minerve | 1997-10-10 | 2026-10-09 | 29 | Orange |
| therapharm.com | thera pharm | 1998-05-26 | 2027-05-25 | 29 | Orange |
| hfw-france.com | hfw france | 1998-05-11 | 2027-05-10 | 29 | Orange |
| incidences-sails.com | incidences sails | 1997-11-21 | 2026-11-20 | 29 | Orange |
| ics-web.com | ics web | 1997-10-25 | 2026-10-24 | 29 | Orange |
| translantic.com | translantic | 1998-06-20 | 2027-06-19 | 29 | Orange |
| eialyon.com | eialyon | 1998-01-27 | 2027-01-26 | 29 | Orange |
| texasrepublic.com | texas republic | 1997-08-04 | 2026-08-03 | 29 | Namecheap |
| jeffrey-jae.com | jeffrey jae | 1997-08-05 | 2026-08-04 | 29 | GoDaddy |
| akeps.com | akeps | 1997-08-03 | 2026-08-02 | 29 | 1Api Gmbh |
| bestbuyerbrokers.com | best buyer brokers | 1997-08-05 | 2026-08-04 | 29 | GoDaddy |
| rocbere.com | roc bere | 1998-04-07 | 2027-04-06 | 29 | Orange |
| lagiroze.com | la giroze | 1998-01-20 | 2027-01-19 | 29 | Orange |
| riverdalebodyshop.com | riverdale body shop | 1997-04-04 | 2026-08-04 | 29 | GoDaddy |
| frenchrealestateocnj.com | french real estate ocnj | 1997-08-05 | 2026-08-04 | 29 | GoDaddy |
| templebethisrael.com | temple beth israel | 1997-08-04 | 2026-08-03 | 29 | Namecheap |
| avocats-pnhg.com | avocats pnhg | 1999-05-28 | 2027-05-28 | 28 | Orange |
| rechard-fga.com | rechard fga | 1999-04-14 | 2027-04-14 | 28 | Orange |
| shoecountry.com | shoe country | 1998-08-03 | 2026-08-02 | 28 | Network Solutions, Llc |
| kwikkopyva.com | kwik kopy va | 1998-08-05 | 2026-08-04 | 28 | GoDaddy |
| firststatebrewers.com | first state brewers | 1998-08-05 | 2026-08-04 | 28 | GoDaddy |
| amazonlily.com | amazon lily | 1998-08-06 | 2026-08-05 | 28 | NameSilo |
| hbs-dlc.com | hbs dlc | 1999-05-22 | 2027-05-22 | 28 | Orange |
| singersew.com | singer sew | 1998-08-04 | 2026-08-03 | 28 | Namecheap |
| voyagertoys.com | voyager toys | 1998-08-03 | 2026-08-02 | 28 | Network Solutions, Llc |
| annarborfinancial.com | ann arbor financial | 1998-08-03 | 2026-08-02 | 28 | Network Solutions, Llc |
| stal-lego.com | stal lego | 1999-01-10 | 2027-01-10 | 28 | Orange |
| poetrysanctuary.com | poetry sanctuary | 1998-08-03 | 2026-08-02 | 28 | Network Solutions, Llc |
| c21bwe.com | c21 bwe | 1998-08-05 | 2026-08-04 | 28 | Tucows Domains Inc. |
| online-smokeshop.com | online smoke shop | 1998-08-05 | 2026-08-04 | 28 | GoDaddy |
| journalofrevisions.com | journal of revisions | 1998-08-03 | 2026-08-02 | 28 | Network Solutions, Llc |
| assasinators.com | assasinators | 1998-08-14 | 2026-08-13 | 28 | Gname.Com Pte. Ltd. |
| coscophil.com | coscophil | 1998-08-03 | 2026-08-02 | 28 | Network Solutions, Llc |
| alpemballage.com | alp emballage | 1999-03-15 | 2027-03-15 | 28 | Orange |
| greatfallsbank.com | great falls bank | 1998-08-03 | 2026-08-02 | 28 | Network Solutions, Llc |
| sleep-comfort.com | sleep comfort | 1998-08-04 | 2026-08-03 | 28 | Namecheap |
| rockcommunitybank.com | rock community bank | 1998-08-03 | 2026-08-02 | 28 | Network Solutions, Llc |
| ranallmetal.com | ran all metal | 1998-08-03 | 2026-08-02 | 28 | Network Solutions, Llc |
| bergencommercial.com | bergen commercial | 1998-08-03 | 2026-08-02 | 28 | Network Solutions, Llc |
| veridentity.com | ver identity | 1999-08-03 | 2026-08-03 | 27 | Enom, Llc |
| souzasounds.com | souza sounds | 1999-08-02 | 2026-08-02 | 27 | Bluehost Inc. |
| rm-f.com | rm f | 1999-08-02 | 2026-08-02 | 27 | Network Solutions, Llc |
| pantiesfetish.com | panties fetish | 1999-08-04 | 2026-08-04 | 27 | GoDaddy |
| europottery.com | euro pottery | 1999-08-03 | 2026-08-03 | 27 | GoDaddy |
| daveturners.com | dave turners | 1999-08-02 | 2026-08-02 | 27 | Network Solutions, Llc |
| grafoilsales.com | grafoil sales | 2000-04-15 | 2027-04-15 | 27 | GoDaddy |
| bbamci.com | bbamci | 1999-08-03 | 2026-08-03 | 27 | GoDaddy |
| railrestaurants.com | rail restaurants | 1999-08-03 | 2026-08-03 | 27 | GoDaddy |
| jetawn.com | jetawn | 1999-08-04 | 2026-08-04 | 27 | Turncommerce, Inc. Dba Namebright.Com |
| plrgroupe.com | plr groupe | 2000-01-04 | 2027-01-04 | 27 | Orange |
| telcosuppliers.com | telco suppliers | 1999-08-04 | 2026-08-04 | 27 | Easydns Technologies Inc. |
| printingartspress.com | printing arts press | 1999-08-03 | 2026-08-03 | 27 | GoDaddy |
| hilditchcarpentry.com | hilditch carpentry | 1999-08-02 | 2026-08-02 | 27 | Bluehost Inc. |
| ba-dachau.com | ba dachau | 1999-08-02 | 2026-08-02 | 27 | Network Solutions, Llc |
| gotoadult.com | go to adult | 1999-08-03 | 2026-08-03 | 27 | Network Solutions, Llc |
| msmeterboxes.com | ms meter boxes | 1999-08-04 | 2026-08-04 | 27 | GoDaddy |
| rickyogliari.com | ricky ogliari | 2000-09-22 | 2027-09-22 | 27 | Gandi Sas |
| the-fancy-that.com | the fancy that | 1999-08-03 | 2026-08-03 | 27 | Namecheap |
| winkeliers.com | winkeliers | 1999-11-03 | 2026-11-03 | 27 | Key-Systems Gmbh |
| mergerplace.com | merger place | 1999-08-02 | 2026-08-02 | 27 | Dreamhost, Llc |
| blaisot.com | blaisot | 2000-01-25 | 2027-01-25 | 27 | Orange |
| noelhenderson.com | noel henderson | 1999-08-02 | 2026-08-02 | 27 | Enom, Llc |
| wallstreetforecaster.com | wall street forecaster | 1999-08-03 | 2026-08-03 | 27 | Namecheap |
| newaytransport.com | neway transport | 1999-10-27 | 2026-10-27 | 27 | Amazon Registrar, Inc. |
| embarrassingproblems.com | embarrassing problems | 1999-08-12 | 2026-08-12 | 27 | Register Spa |
| langtec.com | lang tec | 1999-08-14 | 2026-08-14 | 27 | Iteasy Inc. |
| jurabus.com | jura bus | 2000-05-19 | 2027-05-19 | 27 | Orange |
| raymacdonald.com | ray macdonald | 1999-08-05 | 2026-08-05 | 27 | Rebel Ltd |
| selloninternet.com | sell on internet | 1999-08-04 | 2026-08-04 | 27 | GoDaddy |
| belltowermall.com | bell tower mall | 1999-08-03 | 2026-08-03 | 27 | GoDaddy |
| fontainefruits.com | fontaine fruits | 1999-09-21 | 2026-09-21 | 27 | Orange |
| worldbookreviews.com | world book reviews | 1999-08-03 | 2026-08-03 | 27 | Namecheap |
| magiciel.com | magiciel | 2000-03-14 | 2027-03-14 | 27 | Orange |
| webxtar.com | web xtar | 1999-08-04 | 2026-08-04 | 27 | GoDaddy |
| telewalker.com | tele walker | 1999-08-04 | 2026-08-04 | 27 | Easydns Technologies Inc. |
| pythoncam.com | python cam | 1999-08-06 | 2026-08-06 | 27 | Url Solutions, Inc. |
| the-most-wanted.com | the most wanted | 1999-08-03 | 2026-08-03 | 27 | Namecheap |
| premierweddingplanner.com | premier wedding planner | 1999-08-05 | 2026-08-05 | 27 | NameSilo |
| pagacs.com | pagacs | 1999-08-02 | 2026-08-02 | 27 | Network Solutions, Llc |
| eriebusinesscenter.com | erie business center | 1999-08-03 | 2026-08-03 | 27 | GoDaddy |
| paglight.com | pag light | 1999-08-02 | 2026-08-02 | 27 | Network Solutions, Llc |
| hongkongimporters.com | hong kong importers | 1999-08-03 | 2026-08-03 | 27 | GoDaddy |
| the-strange-attractors.com | the strange attractors | 1999-08-03 | 2026-08-03 | 27 | Namecheap |
| jobs40plus.com | jobs 40 plus | 1999-08-03 | 2026-08-03 | 27 | GoDaddy |
| sherotic.com | sherotic | 1999-08-03 | 2026-08-03 | 27 | Namecheap |
| courbois.com | courbois | 1999-08-03 | 2026-08-03 | 27 | Network Solutions, Llc |
| homesavingsbank.com | home savings bank | 1999-06-04 | 2026-08-03 | 27 | Network Solutions, Llc |
| net-diver.com | net diver | 2000-06-08 | 2027-06-08 | 27 | Registrygate Gmbh |
| dianainosanto.com | diana inosanto | 1999-08-03 | 2026-08-03 | 27 | Dnc Holdings, Inc. |
| inet8.com | inet 8 | 1999-08-04 | 2026-08-04 | 27 | GoDaddy |
| awcommunication.com | aw communication | 1999-08-03 | 2026-08-03 | 27 | GoDaddy |
| 123-jobs.com | 123 jobs | 1999-08-03 | 2026-08-03 | 27 | GoDaddy |
| thebollardgroup.com | the bollard group | 1999-08-02 | 2026-08-02 | 27 | Network Solutions, Llc |
| 4c-up.com | 4c up | 1999-08-04 | 2026-08-04 | 27 | Wild West Domains, Llc |
| eria-instruments.com | eria instruments | 2000-03-01 | 2027-03-01 | 27 | Orange |
| fingerprintchina.com | fingerprint china | 2000-08-03 | 2026-08-03 | 26 | Xiamen 35.Com Information Co., Ltd. |
| murrayhouseinn.com | murray house inn | 2000-08-02 | 2026-08-02 | 26 | Network Solutions, Llc |
| rosemarysgardenhouston.com | rosemarys garden houston | 2000-08-02 | 2026-08-02 | 26 | Register.Com – Network Solutions, Llc |
| fcbalu.com | fcb alu | 2000-08-04 | 2026-08-04 | 26 | Orange |
| mb2525.com | mb 2525 | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| klyde.com | klyde | 2000-08-04 | 2026-08-04 | 26 | Easyspace Limited |
| fcb-aluminium.com | fcb aluminium | 2000-08-04 | 2026-08-04 | 26 | Orange |
| aawesom.com | aawesom | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| goodwichstoller.com | goodwich stoller | 2000-08-02 | 2026-08-02 | 26 | Domain.Com – Network Solutions, Llc |
| rtmcnally.com | rt mcnally | 2000-08-02 | 2026-08-02 | 26 | Network Solutions, Llc |
| theunderwaterconnection.com | the underwater connection | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| destab.com | destab | 2000-08-02 | 2026-08-02 | 26 | Epik Llc |
| integrale-mbd.com | integrale mbd | 2000-08-01 | 2026-08-01 | 26 | Brandon Gray Internet Services Inc. (Dba “Namejuice.Com”) |
| millwoodcabinets.com | millwood cabinets | 2000-08-04 | 2026-08-04 | 26 | GoDaddy |
| bootspflege.com | boots pflege | 2000-08-02 | 2026-08-02 | 26 | Key-Systems Gmbh |
| teensart.com | teens art | 2000-08-04 | 2026-08-04 | 26 | Above.Com Pty Ltd. |
| 100pour100consoles.com | 100 pour 100 consoles | 2001-08-09 | 2027-08-09 | 26 | Orange |
| zbluegrass.com | z bluegrass | 2000-08-03 | 2026-08-03 | 26 | Wild West Domains, Llc |
| baumanandkanner.com | bauman and kanner | 2000-08-04 | 2026-08-04 | 26 | Wild West Domains, Llc |
| touristportals.com | tourist portals | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| oto-multiartha.com | oto multi artha | 2000-08-05 | 2026-08-05 | 26 | Web Commerce Communications Limited Dba Webnic.Cc |
| terralinkcommunications.com | terra link communications | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| fcbaluminium.com | fcb aluminium | 2000-08-04 | 2026-08-04 | 26 | Orange |
| annarboraudio.com | ann arbor audio | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| la-technique.com | la technique | 2000-08-02 | 2026-08-02 | 26 | Domain.Com – Network Solutions, Llc |
| zcountrymusic.com | z country music | 2000-08-03 | 2026-08-03 | 26 | Wild West Domains, Llc |
| torransmfgco.com | torrans mfg co | 2000-08-03 | 2026-08-03 | 26 | Enom, Llc |
| easydn.com | easy dn | 2000-08-03 | 2026-08-03 | 26 | Metaregistrar Bv |
| oralhealthsolutions.com | oral health solutions | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| kylekraus.com | kyle kraus | 2000-08-04 | 2026-08-04 | 26 | Tucows Domains Inc. |
| mt2online.com | mt 2 online | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| lorrainerepro.com | lorraine repro | 2000-10-30 | 2026-10-30 | 26 | Orange |
| firstvehicleservices.com | first vehicle services | 2000-08-02 | 2026-08-02 | 26 | Network Solutions, Llc |
| axi-sa.com | axi sa | 2000-09-13 | 2026-09-13 | 26 | Orange |
| newmerique.com | new merique | 2000-08-04 | 2026-08-04 | 26 | Easyspace Limited |
| reimbursementprinciples.com | reimbursement principles | 2000-03-16 | 2026-08-03 | 26 | GoDaddy |
| c-a-m-s.com | c a m s | 2000-08-02 | 2026-08-02 | 26 | Network Solutions, Llc |
| jacquelinemiddelman.com | jacqueline middelman | 2000-08-02 | 2026-08-02 | 26 | Porkbun Llc |
| msm-automation.com | msm automation | 2000-08-02 | 2026-08-02 | 26 | Ionos Se |
| mlawer.com | mlawer | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| ronaldvandenhoff.com | ronald vandenhoff | 2000-08-03 | 2026-08-03 | 26 | Realtime Register B.V. |
| potusbush.com | potus bush | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| kidcobra.com | kid cobra | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| rwe-individual.com | rwe individual | 2000-09-18 | 2026-09-18 | 26 | Csc Corporate Domains, Inc. |
| lgwfilms.com | lgw films | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| hana-mori.com | hana mori | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| adams-france.com | adams france | 2001-06-22 | 2027-06-22 | 26 | Orange |
| scratch-games.com | scratch games | 2000-08-03 | 2026-08-03 | 26 | Dnc Holdings, Inc. |
| organloftslc.com | organ lofts lc | 2000-08-03 | 2026-08-03 | 26 | Network Solutions, Llc |
| salon2go.com | salon 2 go | 2000-08-02 | 2026-08-02 | 26 | Network Solutions, Llc |
| onlywaterheatersutah.com | only water heaters utah | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| samuelyellinmetalworker.com | samuel yellin metalworker | 2001-08-02 | 2027-08-02 | 26 | Register.Com – Network Solutions, Llc |
| ccs-assistance.com | ccs assistance | 2000-08-04 | 2026-08-04 | 26 | Tucows Domains Inc. |
| construction-schrepfer.com | construction schrepfer | 2000-11-27 | 2026-11-27 | 26 | Orange |
| carlsongis.com | carlson gis | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| great-lakes-recycling.com | great lakes recycling | 2000-08-02 | 2026-08-02 | 26 | Network Solutions, Llc |
| bayaustin.com | bay austin | 2000-08-02 | 2026-08-02 | 26 | Register.Com – Network Solutions, Llc |
| theeasierway.com | the easier way | 2000-08-02 | 2026-08-02 | 26 | Network Solutions, Llc |
| fcb-alu.com | fcb alu | 2000-08-04 | 2026-08-04 | 26 | Orange |
| ppc-dayton.com | ppc dayton | 2000-08-04 | 2026-08-04 | 26 | GoDaddy |
| autoexpert-brest.com | auto expert brest | 2000-09-08 | 2026-09-08 | 26 | Orange |
| goldsealtitle.com | gold seal title | 2000-08-04 | 2026-08-04 | 26 | Wild West Domains, Llc |
| ingresspark.com | ingress park | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| soridis.com | soridis | 2000-08-21 | 2026-08-21 | 26 | Orange |
| smallmunsterlanderdogs.com | small munsterlander dogs | 2000-08-05 | 2026-08-05 | 26 | Rebel Ltd |
| stvsvideo.com | stvs video | 2000-08-03 | 2026-08-03 | 26 | GoDaddy |
| findbizfast.com | find biz fast | 2000-08-04 | 2026-08-04 | 26 | Easyspace Limited |
| tangoediomede.com | tango ediomede | 2000-08-04 | 2026-08-04 | 26 | Tucows Domains Inc. |
| drumsum.com | drum sum | 2001-08-03 | 2027-08-03 | 26 | Register.Com – Network Solutions, Llc |
| china-shenze.com | china shenze | 2001-08-14 | 2026-08-14 | 25 | Gname.Com Pte. Ltd. |
| kranawetvogel.com | kranawetvogel | 2001-08-24 | 2026-08-24 | 25 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| victoriabradford.com | victoria bradford | 2001-08-03 | 2026-08-03 | 25 | Namecheap |
| iowalawfirms.com | iowa law firms | 2001-08-02 | 2026-08-02 | 25 | Register.Com – Network Solutions, Llc |
| plombelecoleane.com | plombe lecoleane | 2001-09-25 | 2026-09-25 | 25 | Orange |
| wychwoodsystems.com | wychwood systems | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| tiendamilitar.com | tienda militar | 2001-08-02 | 2026-08-02 | 25 | Domain.Com – Network Solutions, Llc |
| tombrewsterphotography.com | tom brewster photography | 2001-08-04 | 2026-08-04 | 25 | Tucows Domains Inc. |
| silvermessages.com | silver messages | 2002-05-05 | 2027-05-05 | 25 | GoDaddy |
| gift-boutique.com | gift boutique | 2001-08-04 | 2026-08-04 | 25 | Turncommerce, Inc. Dba Namebright.Com |
| cruoffice.com | cru office | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| sellingisfun.com | selling is fun | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| segurosdeautomoviles.com | seguros de automoviles | 2001-08-05 | 2026-08-05 | 25 | NameSilo |
| boothedesign.com | boothe design | 2001-08-14 | 2026-08-14 | 25 | Gname.Com Pte. Ltd. |
| dotcomliquidations.com | dotcom liquidations | 2001-08-02 | 2026-08-02 | 25 | Ionos Se |
| hhslopitch.com | hh slopitch | 2001-08-03 | 2026-08-03 | 25 | Namecheap |
| hurleyclothes.com | hurley clothes | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| aac-ec.com | aac ec | 2001-11-07 | 2026-11-07 | 25 | Orange |
| cjgould.com | cj gould | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| kerboas.com | kerboas | 2002-04-09 | 2027-04-09 | 25 | Orange |
| abouthealinghands.com | about healing hands | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| alternativbank.com | alternativ bank | 2002-03-08 | 2027-03-08 | 25 | Mesh Digital Limited |
| davidgwilson.com | david g wilson | 2001-08-04 | 2026-08-04 | 25 | GoDaddy |
| iafghans.com | i afghans | 2001-08-03 | 2026-08-03 | 25 | Wild West Domains, Llc |
| espaceduparc.com | espace du parc | 2002-06-21 | 2027-06-21 | 25 | Orange |
| pilot-training-network.com | pilot training network | 2001-08-01 | 2026-08-01 | 25 | Domain Science Kutatási Szolgáltató Korlátolt Felelősségű Társaság |
| medispaconsultant.com | medispa consultant | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| doodlebugduds.com | doodlebug duds | 2001-08-02 | 2026-08-02 | 25 | Network Solutions, Llc |
| pleasuregoddess.com | pleasure goddess | 2001-08-02 | 2026-08-02 | 25 | Sea Wasp, Llc |
| ripcurlwatches.com | ripcurl watches | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| salonsparenova.com | salon spa renova | 2001-08-03 | 2026-08-03 | 25 | Bluehost Inc. |
| surfinghippo.com | surfing hippo | 2001-08-03 | 2026-08-03 | 25 | Automattic Inc. |
| ripcurlwatch.com | ripcurl watch | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| armasmilitares.com | armas militares | 2001-08-02 | 2026-08-02 | 25 | Domain.Com – Network Solutions, Llc |
| midwestexplorer.com | midwest explorer | 2001-08-05 | 2026-08-05 | 25 | NameSilo |
| plagg.com | plagg | 2001-08-03 | 2026-08-03 | 25 | Namecheap |
| vacationworldrv.com | vacation world rv | 2001-08-03 | 2026-08-03 | 25 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| uni-sim.com | uni sim | 2001-08-02 | 2026-08-02 | 25 | Network Solutions, Llc |
| defensive-computing.com | defensive computing | 2002-02-22 | 2027-02-22 | 25 | GoDaddy |
| quicksilverclothing.com | quicksilver clothing | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| snowboardingx.com | snowboarding x | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| exoticvibrations.com | exotic vibrations | 2001-08-04 | 2026-08-04 | 25 | Dynadot |
| hurleyshirt.com | hurley shirt | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| silvertoys.com | silver toys | 2002-03-20 | 2027-03-20 | 25 | Orange |
| christmasloan.com | christmas loan | 2001-08-05 | 2026-08-05 | 25 | Cloudflare, Inc. |
| design-ressources.com | design ressources | 2001-12-21 | 2026-12-21 | 25 | Orange |
| sunbeachsurf.com | sun beach surf | 2001-08-01 | 2026-08-01 | 25 | Mesh Digital Limited |
| distefanoinsurance.com | distefano insurance | 2001-08-02 | 2026-08-02 | 25 | Network Solutions, Llc |
| sterilmusic.com | steril music | 2001-09-07 | 2026-09-07 | 25 | Vautron Rechenzentrum Ag |
| tele21.com | tele 21 | 2001-08-05 | 2026-08-05 | 25 | Dynadot |
| txhayseed.com | tx hayseed | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| baberassociates.com | baber associates | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| explotedteens.com | exploted teens | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| etnieshoes.com | etnie shoes | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| abacusgroupins.com | abacus group ins | 2001-08-03 | 2026-08-03 | 25 | Network Solutions, Llc |
| alphanc.com | alpha nc | 2001-08-03 | 2026-08-03 | 25 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| giassociatesonline.com | gi associates online | 2001-08-03 | 2026-08-03 | 25 | Network Solutions, Llc |
| times-of-india.com | times of india | 2001-08-05 | 2026-08-05 | 25 | NameSilo |
| wettshirtcontents.com | wet tshirt contents | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| commercialhardcapital.com | commercial hard capital | 2005-08-02 | 2030-08-02 | 25 | Network Solutions, Llc |
| exploidedteens.com | exploided teens | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| alternative-bank.com | alternative bank | 2002-03-08 | 2027-03-08 | 25 | Mesh Digital Limited |
| odorcontrolbioworld.com | odor control bioworld | 2001-08-04 | 2026-08-04 | 25 | GoDaddy |
| arizagres.com | arizagres | 2001-08-01 | 2026-08-01 | 25 | Grupo Loading Systems S.L. |
| storymakersinc.com | story makers inc | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| silicon-press.com | silicon press | 2001-08-05 | 2026-08-05 | 25 | Pair Networks, Inc. D/B/A Pair Domains |
| harlowtonmuseum.com | harlowton museum | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| chatadulto.com | chat adulto | 2001-08-02 | 2026-08-02 | 25 | Domain.Com – Network Solutions, Llc |
| jfdco.com | jfd co | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| mvpofamerica.com | mvp of america | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| hurleytshirt.com | hurley tshirt | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| fauvetlagiraudiere.com | fauvet la giraudiere | 2002-05-24 | 2027-05-24 | 25 | Orange |
| orange-sky.com | orange sky | 2001-08-02 | 2026-08-02 | 25 | Ionos Se |
| villacapritownhomes.com | villa capri townhomes | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| weyauwegachamber.com | weyauwega chamber | 2001-08-13 | 2026-08-13 | 25 | Gname.Com Pte. Ltd. |
| e-bress.com | e bress | 2001-08-03 | 2026-08-03 | 25 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| mmsav.com | mms av | 2001-08-13 | 2026-08-13 | 25 | Gname.Com Pte. Ltd. |
| hurleyshirts.com | hurley shirts | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| nakaspo.com | nakaspo | 2001-09-19 | 2026-09-19 | 25 | Japan Registry Services Co., Ltd. |
| vishalfire.com | vishal fire | 2001-08-03 | 2026-08-03 | 25 | GoDaddy |
| koestenbaum.com | koestenbaum | 2002-08-03 | 2026-08-03 | 24 | Network Solutions, Llc |
| india-center.com | india center | 2002-08-02 | 2026-08-02 | 24 | Domain.Com – Network Solutions, Llc |
| quetepica.com | que te pica | 2002-08-02 | 2026-08-02 | 24 | Network Solutions, Llc |
| miakii.com | miakii | 2002-11-05 | 2026-11-05 | 24 | GoDaddy |
| madrugadas.com | madrugadas | 2002-08-02 | 2026-08-02 | 24 | Sea Wasp, Llc |
| newyorkcaptives.com | new york captives | 2002-08-02 | 2026-08-02 | 24 | Register.Com – Network Solutions, Llc |
| ldsseminary.com | lds seminary | 2002-08-05 | 2026-08-05 | 24 | Dynadot |
| fourthoughtpartners.com | four thought partners | 2003-05-14 | 2027-05-14 | 24 | GoDaddy |
| sinogit.com | sino git | 2002-08-13 | 2026-08-13 | 24 | Gname.Com Pte. Ltd. |
| primar-france.com | primar france | 2002-11-06 | 2026-11-06 | 24 | Orange |
| regmyname.com | reg my name | 2002-08-02 | 2026-08-02 | 24 | Enom, Llc |
| reddragonstudio.com | red dragon studio | 2002-08-02 | 2026-08-02 | 24 | Register.Com – Network Solutions, Llc |
| stop-pieces-auto-ravel.com | stop pieces auto ravel | 2002-08-09 | 2026-08-09 | 24 | Orange |
| crowngrants.com | crown grants | 2002-09-17 | 2026-09-17 | 24 | GoDaddy |
| resortscom.com | resorts com | 2002-08-03 | 2026-08-03 | 24 | Dnc Holdings, Inc. |
| genesidesign.com | genesi design | 2002-08-09 | 2026-08-09 | 24 | Beget Llc |
| pwaccess.com | pw access | 2002-08-03 | 2026-08-03 | 24 | Namecheap |
| mondinmagpl.com | mondin mag pl | 2003-02-12 | 2027-02-12 | 24 | Orange |
| rlpeters.com | rl peters | 2002-08-02 | 2026-08-02 | 24 | Enom, Llc |
| aislatecbalear.com | aislatec balear | 2002-08-12 | 2026-08-12 | 24 | Nominalia Internet S.L. |
| ororkepr.com | ororke pr | 2002-08-03 | 2026-08-03 | 24 | GoDaddy |
| getwebmaster.com | get webmaster | 2002-08-05 | 2026-08-05 | 24 | NameSilo |
| incidences-brest.com | incidences brest | 2002-10-21 | 2026-10-21 | 24 | Orange |
| captivesny.com | captives ny | 2002-08-02 | 2026-08-02 | 24 | Register.Com – Network Solutions, Llc |
| stork-mpg.com | stork mpg | 2003-02-25 | 2027-02-25 | 24 | Orange |
| porshop.com | por shop | 2002-08-04 | 2026-08-04 | 24 | Turncommerce, Inc. Dba Namebright.Com |
| jetsetjoy.com | jet set joy | 2003-07-02 | 2027-07-02 | 24 | Internetx Gmbh |
| nycaptives.com | ny captives | 2002-08-02 | 2026-08-02 | 24 | Register.Com – Network Solutions, Llc |
| looking4information.com | looking 4 information | 2002-08-03 | 2026-08-03 | 24 | GoDaddy |
| giftlistplanner.com | gift list planner | 2002-09-13 | 2026-09-13 | 24 | 123-Reg Limited |
| xminternet.com | xm internet | 2002-08-03 | 2026-08-03 | 24 | GoDaddy |
| publicgals.com | public gals | 2002-08-05 | 2026-08-05 | 24 | Eurodns S.A. |
| govisitbolivia.com | go visit bolivia | 2002-08-04 | 2026-08-04 | 24 | GoDaddy |
| travforum.com | trav forum | 2002-08-04 | 2026-08-04 | 24 | GoDaddy |
| shaffnerhouse.com | shaffner house | 2002-05-16 | 2026-08-04 | 24 | GoDaddy |
| bltoolbox.com | bl toolbox | 2002-08-13 | 2026-08-13 | 24 | Gname.Com Pte. Ltd. |
| abc-stores.com | abc stores | 2002-10-30 | 2026-10-30 | 24 | Orange |
| 15minuteloan.com | 15 minute loan | 2002-08-04 | 2026-08-04 | 24 | GoDaddy |
| radiofirsts.com | radio firsts | 2002-08-03 | 2026-08-03 | 24 | Namecheap |
| zhuda-cn.com | zhuda cn | 2002-08-14 | 2026-08-14 | 24 | Gname.Com Pte. Ltd. |
| tightropecommunications.com | tightrope communications | 2002-08-02 | 2026-08-02 | 24 | Register.Com – Network Solutions, Llc |
| mrmulgrew.com | mr mulgrew | 2002-08-02 | 2026-08-02 | 24 | Domain.Com – Network Solutions, Llc |
| cabinetjacquesdavid.com | cabinet jacques david | 2002-11-06 | 2026-11-06 | 24 | Orange |
| videogameuniversity.com | video game university | 2002-08-03 | 2026-08-03 | 24 | Spaceship, Inc. |
| arthritiswalk.com | arthritis walk | 2002-08-03 | 2026-08-03 | 24 | GoDaddy |
| sankyo-seiko-europe.com | sankyo seiko europe | 2003-05-12 | 2027-05-12 | 24 | Orange |
| konabeachweddings.com | kona beach weddings | 2002-08-04 | 2026-08-04 | 24 | GoDaddy |
| teintureries-letourneur.com | teintureries letourneur | 2002-11-21 | 2026-11-21 | 24 | Orange |
| europresseplus.com | europresse plus | 2003-01-20 | 2027-01-20 | 24 | Orange |
| hiokicanada.com | hioki canada | 2002-08-02 | 2026-08-02 | 24 | Network Solutions, Llc |
| govisitperu.com | go visit peru | 2002-08-04 | 2026-08-04 | 24 | GoDaddy |
| innovativemetalwork.com | innovative metalwork | 2002-08-04 | 2026-08-04 | 24 | Easydns Technologies Inc. |
| nancyraymond.com | nancy raymond | 2002-08-03 | 2026-08-03 | 24 | Namecheap |
| govisitargentina.com | go visit argentina | 2002-08-04 | 2026-08-04 | 24 | GoDaddy |
| thai-singles.com | thai singles | 2002-08-02 | 2026-08-02 | 24 | Ionos Se |
| mais-ste-therese.com | mais ste therese | 2003-06-04 | 2027-06-04 | 24 | Orange |
| inspire-wear.com | inspire wear | 2002-09-13 | 2026-09-13 | 24 | GoDaddy |
| chaussures-marco.com | chaussures marco | 2002-09-11 | 2026-09-11 | 24 | Orange |
| thea-rtist.com | the artist | 2002-08-02 | 2026-08-02 | 24 | Bluehost Inc. |
| pornodvdz.com | porno dvdz | 2002-08-03 | 2026-08-03 | 24 | GoDaddy |
| radiusmktg.com | radius mktg | 2002-08-02 | 2026-08-02 | 24 | Dreamhost, Llc |
| captivesnewyork.com | captives new york | 2002-08-02 | 2026-08-02 | 24 | Register.Com – Network Solutions, Llc |
| cabinetmit.com | cabinet mit | 2003-06-25 | 2027-06-25 | 24 | Orange |
| softcorenude.com | softcore nude | 2002-08-02 | 2026-08-02 | 24 | Sea Wasp, Llc |
| farwoodcemtreatmentcenter.com | farwood cem treatment center | 2002-08-02 | 2026-08-02 | 24 | Dreamhost, Llc |
| albens-savoie.com | albens savoie | 2002-08-07 | 2026-08-07 | 24 | Orange |
| restaurantsuply.com | restaurant suply | 2002-08-03 | 2026-08-03 | 24 | Dnc Holdings, Inc. |
| globalidcard.com | global id card | 2002-08-03 | 2026-08-03 | 24 | GoDaddy |
| glennharren.com | glenn harren | 2002-08-02 | 2026-08-02 | 24 | Network Solutions, Llc |
| jahanaraindia.com | jahanara india | 2002-08-03 | 2026-08-03 | 24 | GoDaddy |
| or-nitta.com | or nitta | 2002-08-02 | 2026-08-02 | 24 | Xserver, Inc. |
| ocularoncologymd.com | ocular oncology md | 2002-08-03 | 2026-08-03 | 24 | GoDaddy |
| porndvdz.com | porn dvdz | 2002-08-03 | 2026-08-03 | 24 | GoDaddy |
| maisonaquitaine.com | maison aquitaine | 2002-12-06 | 2026-12-06 | 24 | Orange |
| gaoyaaudio.com | gao ya audio | 2002-08-13 | 2026-08-13 | 24 | Gname.Com Pte. Ltd. |
| paperfrog.com | paper frog | 2002-08-03 | 2026-08-03 | 24 | Namecheap |
| bigbluepill.com | big blue pill | 2002-12-18 | 2026-12-18 | 24 | Wild West Domains, Llc |
| cfabrouen.com | cfa brouen | 2002-08-09 | 2026-08-09 | 24 | Orange |
| mahoganydime.com | mahogany dime | 2002-08-03 | 2026-08-03 | 24 | Bluehost Inc. |
| noor-arfa.com | noor arfa | 2003-08-14 | 2026-08-14 | 23 | Gname.Com Pte. Ltd. |
| baskitballs.com | baskit balls | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| deitche.com | deitche | 2003-09-29 | 2026-08-04 | 23 | GoDaddy |
| archeologicalsite.com | archeological site | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| royalislanderhotel.com | royal islander hotel | 2003-08-14 | 2026-08-14 | 23 | Gname.Com Pte. Ltd. |
| autofillforms.com | autofill forms | 2003-08-02 | 2026-08-02 | 23 | Epik Llc |
| thewellnesscorporation.com | the wellness corporation | 2003-08-02 | 2026-08-02 | 23 | Network Solutions, Llc |
| animatedlovecard.com | animated love card | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| semi-blanquefort.com | semi blanquefort | 2003-10-31 | 2026-10-31 | 23 | Orange |
| aselec-technologies.com | aselec technologies | 2004-01-27 | 2027-01-27 | 23 | Orange |
| emagicshow.com | e magic show | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| miscarraiges.com | miscarraiges | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| musicbymarci.com | music by marci | 2003-11-04 | 2026-11-04 | 23 | GoDaddy |
| musicbymarce.com | music by marce | 2003-11-04 | 2026-11-04 | 23 | GoDaddy |
| currytraders.com | curry traders | 2003-08-02 | 2026-08-02 | 23 | Enom, Llc |
| musicbymarcy.com | music by marcy | 2003-11-04 | 2026-11-04 | 23 | GoDaddy |
| w-jc.com | w jc | 2004-08-18 | 2027-08-18 | 23 | Mesh Digital Limited |
| endo-surgical.com | endo surgical | 2003-08-02 | 2026-08-02 | 23 | Bluehost Inc. |
| whiteasscheeks.com | white ass cheeks | 2003-08-04 | 2026-08-04 | 23 | Tucows Domains Inc. |
| mountaingolfresorts.com | mountain golf resorts | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| 133lux.com | 133 lux | 2003-09-18 | 2026-09-18 | 23 | Csc Corporate Domains, Inc. |
| egyptionpyramid.com | egyption pyramid | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| badcreitloan.com | bad creit loan | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| refilledtoners.com | refilled toners | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| dsssatelites.com | dss satelites | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| studiogsalonanddayspa.com | studio g salon and day spa | 2003-08-02 | 2026-08-02 | 23 | Dreamhost, Llc |
| bodypiercingneedle.com | body piercing needle | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| americahostel.com | america hostel | 2003-08-02 | 2026-08-02 | 23 | Network Solutions, Llc |
| yakimajob.com | yakima job | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| cg-avoues-angers.com | cg avoues angers | 2003-09-09 | 2026-09-09 | 23 | Orange |
| bandwithexperts.com | bandwith experts | 2003-11-04 | 2026-11-04 | 23 | GoDaddy |
| projectiontvreview.com | projection tv review | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| johnpoolehouse.com | john poole house | 2003-09-13 | 2026-09-13 | 23 | GoDaddy |
| gpgpu.com | gpgpu | 2003-08-02 | 2026-08-02 | 23 | Namesecure L.L.C. |
| satelitecode.com | satelite code | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| gamblinghits.com | gambling hits | 2003-08-04 | 2026-08-04 | 23 | Dynadot |
| attworldmet.com | att world met | 2003-09-18 | 2026-09-18 | 23 | Csc Corporate Domains, Inc. |
| tokyoexperts.com | tokyo experts | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| xn--dkw379e.com | xn--dkw379e | 2003-08-07 | 2026-08-07 | 23 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| foodcaloriecharts.com | food calorie charts | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| eleouet.com | eleouet | 2003-08-05 | 2026-08-05 | 23 | Orange |
| rosemontapartments.com | rosemont apartments | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| sageconsultingassociates.com | sage consulting associates | 2003-08-04 | 2026-08-04 | 23 | Tucows Domains Inc. |
| essbs.com | essbs | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| mobilehomefloorplan.com | mobile home floor plan | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| rentalspark.com | rental spark | 2003-08-13 | 2026-08-13 | 23 | Gname.Com Pte. Ltd. |
| navelpeircings.com | navel peircings | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| siaep-lalinde.com | siaep lalinde | 2003-10-30 | 2026-10-30 | 23 | Orange |
| elizabethrosenberg.com | elizabeth rosenberg | 2003-11-04 | 2026-11-04 | 23 | GoDaddy |
| waterfallsalon.com | waterfall salon | 2003-08-05 | 2026-08-05 | 23 | NameSilo |
| musicbymarcie.com | music by marcie | 2003-11-04 | 2026-11-04 | 23 | GoDaddy |
| sail4speed.com | sail 4 speed | 2003-08-01 | 2026-08-01 | 23 | United-Domains Gmbh |
| minimize-taxes.com | minimize taxes | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| senecaschoolhouse.com | seneca schoolhouse | 2003-09-13 | 2026-09-13 | 23 | GoDaddy |
| currencycoverters.com | currency coverters | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| cristianchats.com | cristian chats | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| ewi-f.com | ewi f | 2004-07-28 | 2027-07-28 | 23 | Orange |
| wallpaperandscreensaver.com | wallpaper and screensaver | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| hand-books.com | hand books | 2004-03-17 | 2027-03-17 | 23 | GoDaddy |
| romanvideos.com | roman videos | 2003-08-04 | 2026-08-04 | 23 | Domainclub.Com, Llc |
| oviouest.com | ovi ouest | 2004-03-12 | 2027-03-12 | 23 | Orange |
| nightowlpipeworks.com | night owl pipeworks | 2003-08-03 | 2026-08-03 | 23 | Wild West Domains, Llc |
| hotel-vipclub.com | hotel vip club | 2003-08-14 | 2026-08-14 | 23 | Gname.Com Pte. Ltd. |
| frenchtranslaters.com | french translaters | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| freejokesonline.com | free jokes online | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| frechet-avocats.com | frechet avocats | 2004-01-20 | 2027-01-20 | 23 | Orange |
| romanticlovecard.com | romantic love card | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| tribalarttatoo.com | tribal art tatoo | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| aapl74.com | aapl 74 | 2004-05-24 | 2027-05-24 | 23 | Orange |
| teenageloves.com | teenage loves | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| germantranslaters.com | german translaters | 2003-08-04 | 2026-08-04 | 23 | GoDaddy |
| ihza-ihza.com | ihza ihza | 2003-08-05 | 2026-08-05 | 23 | Pt Ardh Global Indonesia |
| fmifos.com | fmifos | 2004-05-13 | 2027-05-13 | 23 | Orange |
| brestenhancements.com | brest enhancements | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| xn--entspannungspdagoge-swb.com | xn--entspannungspdagoge-swb | 2003-12-14 | 2026-12-14 | 23 | Internetx Gmbh |
| teenielinks.com | teenie links | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| seatac-isp.com | seatac isp | 2003-08-01 | 2026-08-01 | 23 | United-Domains Gmbh |
| seiho-k.com | seiho k | 2003-08-03 | 2026-08-03 | 23 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| dumbcrooknews.com | dumb crook news | 2003-06-04 | 2026-08-04 | 23 | GoDaddy |
| ccjnyc.com | ccj nyc | 2003-08-03 | 2026-08-03 | 23 | Network Solutions, Llc |
| franklinpharmacyandhealthcare.com | franklin pharmacy and healthcare | 2003-08-15 | 2026-08-15 | 23 | Amazon Registrar, Inc. |
| avoues-angers.com | avoues angers | 2003-09-09 | 2026-09-09 | 23 | Orange |
| secretgb.com | secret gb | 2003-08-03 | 2026-08-03 | 23 | Dnc Holdings, Inc. |
| groupe2a.com | groupe 2a | 2004-01-09 | 2027-01-09 | 23 | Orange |
| topbreastpics.com | top breast pics | 2003-08-04 | 2026-08-04 | 23 | Tucows Domains Inc. |
| grc-medecins.com | grc medecins | 2003-10-20 | 2026-10-20 | 23 | Orange |
| niplepiercings.com | niple piercings | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| cableporno.com | cable porno | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| nano-battery.com | nano battery | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| christanchats.com | christan chats | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| aprivateplacetoplay.com | a private place to play | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| ezunix.com | ez unix | 2003-08-04 | 2026-08-04 | 23 | Domeneshop As Dba Domainnameshop.Com |
| rapidtraining.com | rapid training | 2003-08-03 | 2026-08-03 | 23 | Namecheap |
| hotrodsite.com | hot rod site | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| bibliotheque-sallemultimedia.com | bibliotheque salle multimedia | 2003-09-24 | 2026-09-24 | 23 | Orange |
| penisenlargmentpatch.com | penis enlargment patch | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| mikekloc.com | mike kloc | 2003-11-04 | 2026-11-04 | 23 | GoDaddy |
| becknerassociates.com | beckner associates | 2003-08-01 | 2026-08-01 | 23 | Brandon Gray Internet Services Inc. (Dba “Namejuice.Com”) |
| madbak.com | mad bak | 2003-08-02 | 2026-08-02 | 23 | Ionos Se |
| gielcv.com | giel cv | 2004-03-31 | 2027-03-31 | 23 | Orange |
| joelweiskopf.com | joel weiskopf | 2003-08-04 | 2026-08-04 | 23 | GoDaddy |
| heidisearchcenter.com | heidi search center | 2003-08-18 | 2026-08-04 | 23 | Turncommerce, Inc. Dba Namebright.Com |
| prestomaster.com | presto master | 2003-08-02 | 2026-08-02 | 23 | Epik Llc |
| pezcycling.com | pez cycling | 2003-08-03 | 2026-08-03 | 23 | GoDaddy |
| wwwpainrelief.com | www pain relief | 2003-08-02 | 2026-08-02 | 23 | Internet Domain Service Bs Corp |
| buy3drealms.com | buy 3d realms | 2003-08-13 | 2026-08-13 | 23 | Abion Ab |
| t-mobiletogo.com | t mobile to go | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| 1stopnames.com | 1 stop names | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| web-maurice.com | web maurice | 2004-08-02 | 2026-08-02 | 22 | Infomaniak Network Sa |
| gpontes.com | g pontes | 2004-08-04 | 2026-08-04 | 22 | Turncommerce, Inc. Dba Namebright.Com |
| roboteam.com | robo team | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| online-bookmaker.com | online bookmaker | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| dl-wz.com | dl wz | 2004-08-13 | 2026-08-13 | 22 | Gname.Com Pte. Ltd. |
| stutzmanbuilders.com | stutzman builders | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| vanscleaning.com | vans cleaning | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| luxuryrealty-encinitas.com | luxury realty encinitas | 2004-11-04 | 2026-11-04 | 22 | GoDaddy |
| sstranscriptions.com | ss transcriptions | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| qsgrx.com | qsgrx | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| thebargainguys.com | the bargain guys | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| gardeningtricks.com | gardening tricks | 2005-12-07 | 2027-12-07 | 22 | GoDaddy |
| mikeprillimanrealty.com | mike prilliman realty | 2004-08-04 | 2026-08-04 | 22 | Wild West Domains, Llc |
| cheeppurses.com | cheep purses | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| ukdome.com | uk dome | 2004-08-02 | 2026-08-02 | 22 | Register.Com – Network Solutions, Llc |
| corbintrinidad.com | corbin trinidad | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| achprofiles.com | ach profiles | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| flcarshows.com | fl car shows | 2004-08-04 | 2026-08-04 | 22 | GoDaddy |
| bikinilaserhairremoval.com | bikini laser hair removal | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| allianceautocentre.com | alliance auto centre | 2004-08-12 | 2026-08-12 | 22 | Register Spa |
| bryantacc.com | bryant acc | 2008-06-21 | 2030-06-21 | 22 | GoDaddy |
| ny-gi.com | ny gi | 2004-11-11 | 2026-08-03 | 22 | GoDaddy |
| laserhairremovalbrazilian.com | laser hair removal brazilian | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| britekleen.com | brite kleen | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| 51xiezuo.com | 51 xie zuo | 2004-08-13 | 2026-08-13 | 22 | Gname.Com Pte. Ltd. |
| globeretailpark.com | globe retail park | 2004-08-04 | 2026-08-04 | 22 | Tucows Domains Inc. |
| tiresstore.com | tires store | 2004-08-02 | 2026-08-02 | 22 | Sea Wasp, Llc |
| trdat.com | trdat | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| sexescort-prague.com | sex escort prague | 2004-08-02 | 2026-08-02 | 22 | Key-Systems Gmbh |
| lazyprogrammersguide.com | lazy programmers guide | 2004-08-04 | 2026-08-04 | 22 | GoDaddy |
| storymaker-se.com | story maker se | 2004-08-02 | 2026-08-02 | 22 | Network Solutions, Llc |
| kitchycorner.com | kitchy corner | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| sompur.com | sompur | 2005-07-25 | 2027-07-25 | 22 | Orange |
| worklesssellmore.com | work less sell more | 2004-08-02 | 2026-08-02 | 22 | Domain.Com – Network Solutions, Llc |
| mimlyon.com | mim lyon | 2004-08-30 | 2026-08-30 | 22 | Orange |
| completeehr.com | complete ehr | 2004-08-02 | 2026-08-02 | 22 | Domain.Com – Network Solutions, Llc |
| manhattan-gi.com | manhattan gi | 2004-11-11 | 2026-08-03 | 22 | GoDaddy |
| by-day.com | by day | 2004-08-04 | 2026-08-04 | 22 | Turncommerce, Inc. Dba Namebright.Com |
| leclercpneu.com | leclerc pneu | 2005-01-20 | 2027-01-20 | 22 | Orange |
| luxuryrealty-lajolla.com | luxury realty la jolla | 2004-11-04 | 2026-11-04 | 22 | GoDaddy |
| escort-in-prague.com | escort in prague | 2004-08-02 | 2026-08-02 | 22 | Key-Systems Gmbh |
| kennedymedicalimaging.com | kennedy medical imaging | 2004-08-04 | 2026-08-04 | 22 | Tucows Domains Inc. |
| cherrywoodkennels.com | cherrywood kennels | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| desagoa.com | desagoa | 2004-08-03 | 2026-08-03 | 22 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| kitsapcadillac.com | kitsap cadillac | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| qualitycontracts.com | quality contracts | 2004-08-01 | 2026-08-01 | 22 | Sav.Com, Llc |
| mcmpovos.com | mcm povos | 2004-08-02 | 2026-08-02 | 22 | Key-Systems Gmbh |
| wxxuexin.com | wx xue xin | 2004-08-13 | 2026-08-13 | 22 | Hefei Juming Network Technology Co., Ltd |
| chartreusepl.com | chartreuse pl | 2004-08-02 | 2026-08-02 | 22 | Key-Systems Gmbh |
| yoursimplifiedsearch.com | your simplified search | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| ukloancentre.com | uk loan centre | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| rockingchairfactory.com | rocking chair factory | 2004-08-02 | 2026-08-02 | 22 | Enom, Llc |
| thegeorgetownbedandbreakfast.com | the georgetown bed and breakfast | 2004-08-02 | 2026-08-02 | 22 | Hostopia Canada Corp |
| thevegabros.com | the vega bros | 2004-08-04 | 2026-08-04 | 22 | GoDaddy |
| softbutt.com | soft butt | 2004-08-02 | 2026-08-02 | 22 | Sea Wasp, Llc |
| thegeorgetownguesthouse.com | the georgetown guesthouse | 2004-08-02 | 2026-08-02 | 22 | Hostopia Canada Corp |
| cstatlanta.com | cs t atlanta | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| spicesbazar.com | spices bazar | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| francechalets.com | france chalets | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| quiltinggypsy.com | quilting gypsy | 2004-11-08 | 2026-08-04 | 22 | GoDaddy |
| victoriakline.com | victoria kline | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| lancashireweddings.com | lancashire weddings | 2004-08-03 | 2026-08-03 | 22 | Enom, Llc |
| infodizain.com | info dizain | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| freyss.com | freyss | 2004-12-29 | 2026-12-29 | 22 | Orange |
| sellingpages.com | selling pages | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| westhertstimber.com | west herts timber | 2004-08-05 | 2026-08-05 | 22 | Eurodns S.A. |
| alpremontstroy.com | alpremont stroy | 2004-08-05 | 2026-08-05 | 22 | NameSilo |
| smxphoto.com | smx photo | 2004-08-14 | 2026-08-14 | 22 | Gname.Com Pte. Ltd. |
| but-lons.com | but lons | 2005-01-06 | 2027-01-06 | 22 | Orange |
| bollingerlaw1.com | bollinger law 1 | 2004-08-02 | 2026-08-02 | 22 | Network Solutions, Llc |
| affiliatenuke.com | affiliate nuke | 2004-08-04 | 2026-08-04 | 22 | GoDaddy |
| ccreditbank.com | c credit bank | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| lowridres.com | lowridres | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| gravityinformatics.com | gravity informatics | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| eurexyvetot.com | eurexy vetot | 2004-11-24 | 2026-11-24 | 22 | Orange |
| cosmetic-faces-surgery.com | cosmetic faces surgery | 2004-08-03 | 2026-08-03 | 22 | 123-Reg Limited |
| stonemice.com | stone mice | 2004-08-02 | 2026-08-02 | 22 | Dreamhost, Llc |
| web-mauritius.com | web mauritius | 2004-08-02 | 2026-08-02 | 22 | Infomaniak Network Sa |
| thelazyprogrammersguide.com | the lazy programmers guide | 2004-08-04 | 2026-08-04 | 22 | GoDaddy |
| winene.com | wine ne | 2004-08-03 | 2026-08-03 | 22 | Wild West Domains, Llc |
| caterpro.com | cater pro | 2004-08-01 | 2026-08-01 | 22 | 1Api Gmbh |
| scp-quiniou-et-associes.com | scp quiniou et associes | 2005-06-23 | 2027-06-23 | 22 | Orange |
| advancedjc.com | advanced jc | 2004-08-12 | 2026-08-12 | 22 | Register Spa |
| rileyequipmentsales.com | riley equipment sales | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| aw-naturstein.com | aw naturstein | 2005-05-02 | 2027-05-02 | 22 | Hetzner Online Gmbh |
| corp-centre.com | corp centre | 2004-08-05 | 2026-08-05 | 22 | Rebel Ltd |
| carbidefinger.com | carbide finger | 2004-08-03 | 2026-08-03 | 22 | 123-Reg Limited |
| xn--sss29eb1bxoq83u.com | xn--sss29eb1bxoq83u | 2004-08-04 | 2026-08-04 | 22 | Tucows Domains Inc. |
| holsolutions.com | hol solutions | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| distillator.com | distillator | 2005-08-05 | 2027-08-05 | 22 | Onlinenic, Inc. |
| c32s.com | c32s | 2005-07-05 | 2027-07-05 | 22 | Orange |
| fastliquidator.com | fast liquidator | 2004-08-02 | 2026-08-02 | 22 | Enom, Llc |
| theranovatherapeutics.com | theranova therapeutics | 2004-08-04 | 2026-08-04 | 22 | Tucows Domains Inc. |
| infinityofcharlotte.com | infinity of charlotte | 2004-08-02 | 2026-08-02 | 22 | Network Solutions, Llc |
| roberthidde.com | robert hidde | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| smashingames.com | smashingames | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| nyc-gi.com | nyc gi | 2004-11-11 | 2026-08-03 | 22 | GoDaddy |
| luxuryrealty-rsf.com | luxury realty rsf | 2004-11-04 | 2026-11-04 | 22 | GoDaddy |
| brazilianlaserhairremoval.com | brazilian laser hair removal | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| healthcare-providers.com | healthcare providers | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| sipst.com | sipst | 2004-12-10 | 2026-12-10 | 22 | Orange |
| keopsworkflow.com | keops workflow | 2004-08-05 | 2026-08-05 | 22 | Dinahosting S.L. |
| hyperspeedpowerlines.com | hyperspeed powerlines | 2004-08-02 | 2026-08-02 | 22 | Hostopia Canada Corp |
| tc-event.com | tc event | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| metromonial.com | metromonial | 2004-08-03 | 2026-08-03 | 22 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| tazweb.com | taz web | 2004-08-02 | 2026-08-02 | 22 | Network Solutions, Llc |
| leyipen.com | le yi pen | 2004-08-13 | 2026-08-13 | 22 | Gname.Com Pte. Ltd. |
| webbam.com | webbam | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| dmacsoftware.com | dmac software | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| ccahag.com | ccahag | 2004-09-03 | 2026-09-03 | 22 | Orange |
| washuntara.com | washuntara | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| rosewoodbullmastiffs.com | rosewood bullmastiffs | 2004-08-04 | 2026-08-04 | 22 | GoDaddy |
| laserhairremovalbikini.com | laser hair removal bikini | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| yeutinhoc.com | yeu tinhoc | 2004-08-05 | 2026-08-05 | 22 | NameSilo |
| kdk-t.com | kdk t | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| cyclopaedias.com | cyclopaedias | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| sijiji.com | si ji ji | 2004-08-13 | 2026-08-13 | 22 | Gname.Com Pte. Ltd. |
| submissionurl.com | submission url | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| worldwordweb.com | world word web | 2004-01-06 | 2026-08-04 | 22 | GoDaddy |
| musicfollie.com | music follie | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| johnmarut.com | john marut | 2004-08-02 | 2026-08-02 | 22 | Register.Com – Network Solutions, Llc |
| networkedplaces.com | networked places | 2004-08-02 | 2026-08-02 | 22 | Annulet Llc |
| fieldhockeyspecialties.com | field hockey specialties | 2004-08-03 | 2026-08-03 | 22 | Wild West Domains, Llc |
| arcadiastrategies.com | arcadia strategies | 2004-08-02 | 2026-08-02 | 22 | Register.Com – Network Solutions, Llc |
| ginowheels.com | gino wheels | 2004-08-04 | 2026-08-04 | 22 | Turncommerce, Inc. Dba Namebright.Com |
| tomit.com | tom it | 2004-08-01 | 2026-08-01 | 22 | 1Api Gmbh |
| bremertoncadillac.com | bremerton cadillac | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| cpr4rx.com | cpr 4 rx | 2004-08-04 | 2026-08-04 | 22 | NameSilo |
| dokokani.com | doko kani | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| waywardaunty.com | wayward aunty | 2004-08-02 | 2026-08-02 | 22 | Register.Com – Network Solutions, Llc |
| pinklandhk.com | pink land hk | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| duckwhere.com | duck where | 2004-08-03 | 2026-08-03 | 22 | Ionos Se |
| ul-italia.com | ul italia | 2004-08-04 | 2026-08-04 | 22 | Tucows Domains Inc. |
| synergysalonanddayspa.com | synergy salon and day spa | 2004-08-02 | 2026-08-02 | 22 | Network Solutions, Llc |
| shimingtong.com | shi ming tong | 2004-08-13 | 2026-08-13 | 22 | Gname.Com Pte. Ltd. |
| horsebarndesigns.com | horse barn designs | 2004-08-02 | 2026-08-02 | 22 | Domain.Com – Network Solutions, Llc |
| camsweeties.com | cam sweeties | 2004-08-04 | 2026-08-04 | 22 | Domainclub.Com, Llc |
| keithdmilby.com | keith d milby | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| emagware.com | emag ware | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| palmbeachpages.com | palm beach pages | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| onsite-computing.com | onsite computing | 2004-05-18 | 2026-08-03 | 22 | Namecheap |
| sunstationonline.com | sun station online | 2004-08-03 | 2026-08-03 | 22 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| pamdanziger.com | pam danziger | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| tcevent.com | tc event | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| davidtechnologies.com | david technologies | 2004-08-02 | 2026-08-02 | 22 | Network Solutions, Llc |
| joselynmarie.com | joselyn marie | 2004-06-02 | 2026-08-03 | 22 | Namecheap |
| nackte-frauen.com | nackte frauen | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| prague-escort-service.com | prague escort service | 2004-08-02 | 2026-08-02 | 22 | Key-Systems Gmbh |
| thequiltinggypsy.com | the quilting gypsy | 2004-11-08 | 2026-08-04 | 22 | GoDaddy |
| waywardauntys.com | wayward auntys | 2004-08-02 | 2026-08-02 | 22 | Register.Com – Network Solutions, Llc |
| classactphotography.com | class act photography | 2004-08-02 | 2026-08-02 | 22 | Hostopia Canada Corp |
| lewislambert.com | lewis lambert | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| goldenarrow-dr.com | golden arrow dr | 2004-08-04 | 2026-08-04 | 22 | NameSilo |
| scintilon.com | scintilon | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| dkpneus.com | dk pneus | 2005-01-20 | 2027-01-20 | 22 | Orange |
| archivage-moderne.com | archivage moderne | 2004-10-26 | 2026-10-26 | 22 | Orange |
| artisananglais.com | artisan anglais | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| conneticuthousesforsale.com | conneticut houses for sale | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| zqqsdy.com | zqqsdy | 2004-08-14 | 2026-08-14 | 22 | Gname.Com Pte. Ltd. |
| garage-mercier.com | garage mercier | 2004-12-27 | 2026-12-27 | 22 | Orange |
| cheepsnowmobiles.com | cheep snowmobiles | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| nothinginthisworld.com | nothing in this world | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| rulethree.com | rule three | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| mailboro.com | mailboro | 2004-08-05 | 2026-08-05 | 22 | Namebay Sam |
| yomammajoke.com | yo mamma joke | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| blackhills360.com | black hills 360 | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| gcbois.com | gc bois | 2005-03-16 | 2027-03-16 | 22 | Orange |
| linexofhuntingtonbeach.com | linex of huntington beach | 2004-08-03 | 2026-08-03 | 22 | Network Solutions, Llc |
| diablocreative.com | diablo creative | 2004-08-03 | 2026-08-03 | 22 | Bluehost Inc. |
| gescontainer.com | ges container | 2004-08-02 | 2026-08-02 | 22 | Network Solutions, Llc |
| sevillecs.com | seville cs | 2004-08-02 | 2026-08-02 | 22 | Network Solutions, Llc |
| celebnewsnow.com | celeb news now | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| mingshi8.com | ming shi 8 | 2004-08-13 | 2026-08-13 | 22 | Gname.Com Pte. Ltd. |
| wetlick.com | wet lick | 2004-08-02 | 2026-08-02 | 22 | Sea Wasp, Llc |
| infusionmassage.com | infusion massage | 2004-05-22 | 2026-08-02 | 22 | Epik Llc |
| muslimmilitarymembers.com | muslim military members | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| zambiantraveller.com | zambian traveller | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| consciousvoices.com | conscious voices | 2004-08-03 | 2026-08-03 | 22 | GoDaddy |
| scandiaromana.com | scandia romana | 2004-08-03 | 2026-08-03 | 22 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| redsoxstats.com | red sox stats | 2004-08-03 | 2026-08-03 | 22 | Namecheap |
| mercmex.com | merc mex | 2004-08-04 | 2026-08-04 | 22 | Tucows Domains Inc. |
| oshawasingles.com | oshawa singles | 2004-08-05 | 2026-08-05 | 22 | NameSilo |
| szjiangwei.com | sz jiang wei | 2004-08-14 | 2026-08-14 | 22 | Gname.Com Pte. Ltd. |
| amospheres.com | amospheres | 2005-08-02 | 2026-08-02 | 21 | Network Solutions, Llc |
| buyhomesindenver.com | buy homes in denver | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| pinchependejos.com | pinche pendejos | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| ricecustomguitars.com | rice custom guitars | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| rich-media-player.com | rich media player | 2005-08-02 | 2026-08-02 | 21 | Ionos Se |
| temprpedic.com | temprpedic | 2005-02-04 | 2026-08-04 | 21 | GoDaddy |
| dfalink.com | dfa link | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| cookiesnmorestore.com | cookies n more store | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| cruncheasy.com | crunch easy | 2005-08-06 | 2026-08-06 | 21 | Onlinenic, Inc. |
| homesinweldcounty.com | homes in weld county | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| newmexicohomeinspection.com | new mexico home inspection | 2005-08-05 | 2026-08-05 | 21 | Cloudflare, Inc. |
| energ-y.com | energ y | 2005-08-02 | 2026-08-02 | 21 | Dreamhost, Llc |
| javiso.com | javiso | 2005-08-03 | 2026-08-03 | 21 | Ionos Se |
| rcswatercraft.com | rcs watercraft | 2005-08-02 | 2026-08-02 | 21 | Hostopia Canada Corp |
| ibclan.com | ib clan | 2005-08-12 | 2026-08-12 | 21 | Register Spa |
| wsiedge.com | wsi edge | 2005-08-22 | 2026-08-22 | 21 | Safenames Ltd. |
| whitewatersatlanta.com | white waters atlanta | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| mbkwellness.com | mbk wellness | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| sakuraproductionusa.com | sakura production usa | 2005-08-04 | 2026-08-04 | 21 | Tucows Domains Inc. |
| leifgrunseth.com | leif grunseth | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| jennifermarshallphotography.com | jennifer marshall photography | 2005-08-04 | 2026-08-04 | 21 | Tucows Domains Inc. |
| bendriverwild.com | bend river wild | 2005-08-03 | 2026-08-03 | 21 | Wild West Domains, Llc |
| garymyersassociates.com | gary myers associates | 2005-08-02 | 2026-08-02 | 21 | Register.Com – Network Solutions, Llc |
| vancouverpersonaltrainer.com | vancouver personal trainer | 2005-08-04 | 2026-08-04 | 21 | Turncommerce, Inc. Dba Namebright.Com |
| albanymailservice.com | albany mail service | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| ozarkherbandspice.com | ozark herb and spice | 2005-08-02 | 2026-08-02 | 21 | Key-Systems Gmbh |
| musicberber.com | music berber | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| emulaunch.com | emu launch | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| heydonclan.com | heydon clan | 2005-08-03 | 2026-08-03 | 21 | Dreamhost, Llc |
| mesajesdetexto.com | mesajes de texto | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| pappasmotel.com | pappas motel | 2005-08-01 | 2026-08-03 | 21 | GoDaddy |
| utahhomeinspection.com | utah home inspection | 2005-08-05 | 2026-08-05 | 21 | Cloudflare, Inc. |
| sportseyeinjuries.com | sports eye injuries | 2005-08-02 | 2026-08-02 | 21 | Network Solutions, Llc |
| msvoyages.com | ms voyages | 2006-05-10 | 2027-05-10 | 21 | Orange |
| montanahomeinspection.com | montana home inspection | 2005-08-05 | 2026-08-05 | 21 | Cloudflare, Inc. |
| mediacubby.com | media cubby | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| natureshorse.com | natures horse | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| ibngrandparents.com | ibn grandparents | 2005-08-02 | 2026-08-02 | 21 | Domain.Com – Network Solutions, Llc |
| railphotoexpress.com | rail photo express | 2005-08-17 | 2026-08-17 | 21 | Ionos Se |
| ericfriedberg.com | eric friedberg | 2005-08-02 | 2026-08-02 | 21 | Network Solutions, Llc |
| hopesh.com | hopesh | 2005-08-13 | 2026-08-13 | 21 | Gname.Com Pte. Ltd. |
| fortwayneobituary.com | fort wayne obituary | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| sembca.com | sembca | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| neroshoney.com | neros honey | 2007-06-11 | 2028-04-28 | 21 | GoDaddy |
| onlinewieghtloss.com | online wieght loss | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| ctreglia.com | c treglia | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| wollenschlaegerberlin.com | wollenschlaeger berlin | 2005-08-12 | 2026-08-12 | 21 | Ionos Se |
| sumnerflorist.com | sumner florist | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| trgconcessions.com | trg concessions | 2005-08-02 | 2026-08-02 | 21 | Network Solutions, Llc |
| specflic.com | spec flic | 2005-08-03 | 2026-08-03 | 21 | Ionos Se |
| debtgeneration.com | debt generation | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| paultjackson.com | paul t jackson | 2005-08-03 | 2026-08-03 | 21 | 123-Reg Limited |
| yalcinlarmetal.com | yalcinlar metal | 2005-11-24 | 2026-11-24 | 21 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| jmlpoker.com | jml poker | 2005-11-02 | 2026-08-03 | 21 | GoDaddy |
| ussafetyservices.com | us safety services | 2005-08-03 | 2026-08-03 | 21 | Wild West Domains, Llc |
| premierimageagency.com | premier image agency | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| homebusinessworker.com | home business worker | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| lfamichigan.com | lfa michigan | 2005-08-02 | 2026-08-02 | 21 | Register.Com – Network Solutions, Llc |
| alisaclum.com | alisa clum | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| asa-company.com | asa company | 2006-05-22 | 2027-05-22 | 21 | Orange |
| discount-dance-shoes.com | discount dance shoes | 2005-04-28 | 2026-08-04 | 21 | GoDaddy |
| cabinet-hillel.com | cabinet hillel | 2006-05-22 | 2027-05-22 | 21 | Orange |
| downloadproject.com | download project | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| deshkalindia.com | deshkal india | 2005-08-03 | 2026-08-03 | 21 | Fluccs – The Australian Cloud Pty Ltd |
| boxofboxesplus.com | box of boxes plus | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| dancewear-discount.com | dancewear discount | 2005-04-28 | 2026-08-04 | 21 | GoDaddy |
| easylondonaccomodation.com | easy london accomodation | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| irodori-kobo.com | irodori kobo | 2005-09-14 | 2026-09-14 | 21 | Idc Frontier Inc. |
| streunenderwolf.com | streunender wolf | 2005-08-29 | 2026-08-29 | 21 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| heliosperandio.com | helios perandio | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| crete-holiday-villa.com | crete holiday villa | 2005-08-03 | 2026-08-03 | 21 | 123-Reg Limited |
| ginnywinny.com | ginny winny | 2005-11-01 | 2026-08-03 | 21 | GoDaddy |
| isimmer.com | i simmer | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| carwinsolutions.com | carwin solutions | 2005-08-03 | 2026-08-03 | 21 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| cabinet-hiller.com | cabinet hiller | 2006-04-06 | 2027-04-06 | 21 | Orange |
| wirelsssync.com | wirelss sync | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| twofacedcosmetics.com | two faced cosmetics | 2005-02-04 | 2026-08-04 | 21 | GoDaddy |
| benschmanke.com | ben schmanke | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| sirrot.com | sirrot | 2005-04-21 | 2026-08-03 | 21 | GoDaddy |
| bringthembackalive.com | bring them back alive | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| metroheating-cooling.com | metro heating cooling | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| lingerie-relax.com | lingerie relax | 2005-08-05 | 2026-08-05 | 21 | Dynadot |
| skoretz.com | skoretz | 2005-08-03 | 2026-08-03 | 21 | Network Solutions, Llc |
| full-poker.com | full poker | 2005-08-04 | 2026-08-04 | 21 | NameSilo |
| primeevilproductions.com | prime evil productions | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| eroticshortfilms.com | erotic short films | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| kenipintao.com | kenipintao | 2005-08-02 | 2026-08-02 | 21 | Network Solutions, Llc |
| caribbeanxc.com | caribbean xc | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| heritage-hra.com | heritage hra | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| atterberryauctions.com | atterberry auctions | 2005-02-04 | 2026-08-04 | 21 | GoDaddy |
| centeringgroupcare.com | centering group care | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| arthritispractice.com | arthritis practice | 2005-08-05 | 2026-08-05 | 21 | NameSilo |
| awm-auto.com | awm auto | 2005-08-15 | 2026-08-15 | 21 | Center Of Ukrainian Internet Names (Ukrnames) |
| britopinion.com | brit opinion | 2005-08-04 | 2026-08-04 | 21 | Turncommerce, Inc. Dba Namebright.Com |
| cirquesdesoleil.com | cirques de soleil | 2005-08-03 | 2026-08-03 | 21 | Wild West Domains, Llc |
| flexibleductmachinery.com | flexible duct machinery | 2005-08-04 | 2026-08-04 | 21 | Tucows Domains Inc. |
| rycvv.com | rycvv | 2005-08-04 | 2026-08-04 | 21 | Tucows Domains Inc. |
| theprayerlife.com | the prayer life | 2005-08-02 | 2026-08-02 | 21 | Bluehost Inc. |
| theaerojetset.com | the aero jet set | 2005-08-02 | 2026-08-02 | 21 | Network Solutions, Llc |
| wgdarchitects.com | wgd architects | 2005-08-03 | 2026-08-03 | 21 | Enom, Llc |
| curryholdings.com | curry holdings | 2007-08-02 | 2028-08-02 | 21 | Network Solutions, Llc |
| starzonbroadway.com | starzonbroadway | 2005-08-02 | 2026-08-02 | 21 | Hostopia Canada Corp |
| kdsvehicles.com | kds vehicles | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| grouprank.com | group rank | 2005-08-02 | 2026-08-02 | 21 | Sea Wasp, Llc |
| pcbang21.com | pc bang 21 | 2005-08-05 | 2026-08-05 | 21 | Megazone Corp., Dba Hosting.Kr |
| sy2s.com | sy2s | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| immunobiotix.com | immunobiotix | 2005-08-12 | 2026-08-12 | 21 | Abion Ab |
| tie-shirt.com | tie shirt | 2006-05-21 | 2027-05-21 | 21 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| homesinadamscounty.com | homes in adams county | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| samballc.com | samba llc | 2005-08-04 | 2026-08-04 | 21 | Dynadot |
| kansashomeinspection.com | kansas home inspection | 2005-08-05 | 2026-08-05 | 21 | Cloudflare, Inc. |
| rich-media-design.com | rich media design | 2005-08-02 | 2026-08-02 | 21 | Ionos Se |
| haileyanne.com | hailey anne | 2005-08-03 | 2026-08-03 | 21 | Ionos Se |
| ml-centrevar.com | ml centre var | 2006-04-25 | 2027-04-25 | 21 | Orange |
| comfortinnmanhatten.com | comfort inn manhatten | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| 0cwen.com | 0cwen | 2005-02-04 | 2026-08-04 | 21 | GoDaddy |
| steveveidorthe2nd.com | steve veidor the 2nd | 2005-08-03 | 2026-08-03 | 21 | Wild West Domains, Llc |
| tag-technologies.com | tag technologies | 2005-09-29 | 2026-09-29 | 21 | Orange |
| buyhomesinbouldercounty.com | buy homes in boulder county | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| morgangirl.com | morgan girl | 2005-08-04 | 2026-08-04 | 21 | Tucows Domains Inc. |
| rich-media-presentation.com | rich media presentation | 2005-08-02 | 2026-08-02 | 21 | Ionos Se |
| bringembackalive.com | bring em back alive | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| letsgogalapagos.com | lets go galapagos | 2005-08-02 | 2026-08-02 | 21 | Porkbun Llc |
| fatebonygirls.com | fate bony girls | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| constantinorosario.com | constantino rosario | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| abendrental.com | abend rental | 2005-08-03 | 2026-08-03 | 21 | Wild West Domains, Llc |
| axeplus.com | axe plus | 2005-11-25 | 2026-11-25 | 21 | Orange |
| category5engineering.com | category 5 engineering | 2005-08-02 | 2026-08-02 | 21 | Network Solutions, Llc |
| hipposhotdogs.com | hippo shot dogs | 2005-08-05 | 2026-08-05 | 21 | Cloudflare, Inc. |
| au2b.com | au 2 b | 2005-08-03 | 2026-08-03 | 21 | Wild West Domains, Llc |
| supersuperjuegos.com | super super juegos | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| onlinebaccarrat.com | online baccarrat | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| bw-ms.com | bw ms | 2005-04-15 | 2026-08-03 | 21 | GoDaddy |
| cockspussy.com | cocks pussy | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| aboutsunriver.com | about sunriver | 2005-08-03 | 2026-08-03 | 21 | Wild West Domains, Llc |
| c5es.com | c5es | 2005-08-02 | 2026-08-02 | 21 | Network Solutions, Llc |
| nationalgiftbasket.com | national gift basket | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| pericosgava.com | pericos gava | 2005-08-12 | 2026-08-12 | 21 | Nominalia Internet S.L. |
| acteam-industries.com | ac team industries | 2006-07-07 | 2027-07-07 | 21 | Orange |
| lenourrain.com | le nourrain | 2006-01-24 | 2027-01-24 | 21 | Orange |
| jimandcarmen.com | jim and carmen | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| floatationswimsuit.com | floatation swimsuit | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| carlossserrano.com | carlossserrano | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| addonixcomputers.com | addonix computers | 2005-08-03 | 2026-08-03 | 21 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| bloteleclit.com | bloteleclit | 2006-03-08 | 2027-03-08 | 21 | Orange |
| jbi-isolation.com | jbi isolation | 2005-08-09 | 2026-08-09 | 21 | Orange |
| sl-tss.com | sl tss | 2005-08-02 | 2026-08-02 | 21 | Ionos Se |
| lcsnaut.com | lcs naut | 2005-08-02 | 2026-08-02 | 21 | Domain.Com – Network Solutions, Llc |
| dteengergy.com | dteengergy | 2005-08-01 | 2026-08-01 | 21 | Key-Systems Gmbh |
| cabinet-desfrenne.com | cabinet desfrenne | 2006-03-20 | 2027-03-20 | 21 | Orange |
| processrank.com | process rank | 2005-08-02 | 2026-08-02 | 21 | Sea Wasp, Llc |
| hitechunited.com | hi tech united | 2005-08-05 | 2026-08-05 | 21 | Web Commerce Communications Limited Dba Webnic.Cc |
| wallpaperaddict.com | wallpaper addict | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| lincolnfarmerscoop.com | lincoln farmers coop | 2005-08-02 | 2026-08-02 | 21 | Network Solutions, Llc |
| danhait.com | dan hait | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| jenniferdeacon.com | jennifer deacon | 2005-08-03 | 2026-08-03 | 21 | 123-Reg Limited |
| sopa15.com | sopa 15 | 2006-04-10 | 2027-04-10 | 21 | Orange |
| pimpmylaptop.com | pimp my laptop | 2005-08-01 | 2026-08-01 | 21 | Sav.Com, Llc |
| hampsteadvillagepreschool.com | hampstead village preschool | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| zaomi.com | zaomi | 2005-08-05 | 2026-08-05 | 21 | Cloudflare, Inc. |
| kitputas.com | kit putas | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| cot-usa.com | cot usa | 2005-08-02 | 2026-08-02 | 21 | Ionos Se |
| freekidgamesdownloads.com | free kid games downloads | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| sarasotachristmas.com | sarasota christmas | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| heritagehardwoodflooring.com | heritage hardwood flooring | 2005-08-03 | 2026-08-03 | 21 | Enom, Llc |
| dance-wear-superstore.com | dance wear superstore | 2005-04-28 | 2026-08-04 | 21 | GoDaddy |
| quantitybook.com | quantity book | 2005-08-03 | 2026-08-03 | 21 | Wild West Domains, Llc |
| bulletproofusa.com | bulletproof usa | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| labm-biosante.com | labm biosante | 2006-06-23 | 2027-06-23 | 21 | Orange |
| lindasclayton.com | lindas clayton | 2005-08-02 | 2026-08-02 | 21 | Dreamhost, Llc |
| casalemattei.com | casa le mattei | 2005-08-03 | 2026-08-03 | 21 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| gangstersandthugs.com | gangsters and thugs | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| xtralargepenis.com | xtralargepenis | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| primevalproductions.com | primeval productions | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| adsforindia.com | ads for india | 2005-08-05 | 2026-08-05 | 21 | NameSilo |
| selectlincolnshire.com | select lincolnshire | 2005-08-03 | 2026-08-03 | 21 | 123-Reg Limited |
| huishoudbeurs.com | huishoud beurs | 2005-08-05 | 2026-08-05 | 21 | Eurodns S.A. |
| abbysbooks.com | abbys books | 2005-08-03 | 2026-08-03 | 21 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| anten-na.com | antenna | 2005-08-03 | 2026-08-03 | 21 | Enom, Llc |
| rrvans.com | rr vans | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| edmontonfleamarkets.com | edmonton flea markets | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| jstephensams.com | j stephen sams | 2005-07-13 | 2026-08-04 | 21 | GoDaddy |
| jamaicapsychic.com | jamaica psychic | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| multitekarge.com | multitek arge | 2005-09-01 | 2026-09-01 | 21 | Turkticaret.Net Yazılım Hizmetleri Sanayi Ve Ticaret A.Ş. |
| heartsawaken.com | hearts awaken | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| officertrainer.com | officer trainer | 2005-11-04 | 2026-11-04 | 21 | GoDaddy |
| drunkredhead.com | drunk redhead | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| woestelandtservices.com | woestelandt services | 2006-02-21 | 2027-02-21 | 21 | Orange |
| homesinlarimercounty.com | homes in larimer county | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| yourfreefiles.com | your free files | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| bringingbackthespirit.com | bringing back the spirit | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| secrectrecipies.com | secrectrecipies | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| rasresource.com | ras resource | 2005-08-04 | 2026-08-04 | 21 | Domain Registration Services, Inc. Dba Dotearth.Com |
| yumi-artflower.com | yumi art flower | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| candlewickinteriors.com | candlewick interiors | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| aboutriverwild.com | about river wild | 2005-08-03 | 2026-08-03 | 21 | Wild West Domains, Llc |
| studio57salon.com | studio 57 salon | 2005-08-02 | 2026-08-02 | 21 | Register.Com – Network Solutions, Llc |
| lutzgoepfert.com | lutz goepfert | 2005-08-03 | 2026-08-03 | 21 | Bluehost Inc. |
| musthavediamonds.com | must have diamonds | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| tuttartgalleries.com | tutt art galleries | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| workinginthuk.com | working in th uk | 2005-08-04 | 2026-08-04 | 21 | GoDaddy |
| themissionschool.com | the mission school | 2005-08-03 | 2026-08-03 | 21 | GoDaddy |
| moromine.com | moromine | 2005-08-04 | 2026-08-04 | 21 | Arcanes Technologies |
| cassknits.com | cass knits | 2005-08-02 | 2026-08-02 | 21 | Dreamhost, Llc |
| floralbook.com | floral book | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| centeringparenting.com | centering parenting | 2005-08-03 | 2026-08-03 | 21 | Namecheap |
| clarionmaingate.com | clarion main gate | 2005-08-03 | 2026-08-03 | 21 | Wild West Domains, Llc |
Established .COM Domains 10-20 years
These .COM domains have been registered for 10-20 years.
| Domain | Component | Registration | Expiration | Age | Registrar |
|---|---|---|---|---|---|
| homeofthedrew.com | home of the drew | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| symeonstudio.com | symeon studio | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| dghanzhong.com | dg hanzhong | 2006-08-13 | 2026-08-13 | 20 | Gname.Com Pte. Ltd. |
| tech-response.com | tech response | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| school-gear.com | school gear | 2006-08-04 | 2026-08-04 | 20 | NameSilo |
| pattyelie.com | patty elie | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| monkeyjoenc.com | monkey joe nc | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| nickjcolessides.com | nick j coles sides | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| tinseltownstories.com | tinseltown stories | 2007-06-29 | 2027-06-29 | 20 | Metaregistrar Bv |
| houstonpcgeeks.com | houston pc geeks | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| apiccrious.com | apiccrious | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| newport-tours.com | newport tours | 2006-08-04 | 2026-08-04 | 20 | GoDaddy |
| hxyyrc.com | hxyy rc | 2006-08-07 | 2026-08-07 | 20 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| allstaryorkies.com | all star yorkies | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| timsemelroth.com | tim semelroth | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| amcmushrooms.com | amc mushrooms | 2006-08-03 | 2026-08-03 | 20 | Enom, Llc |
| nnnleasesforsale.com | nnn leases for sale | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| theaddictivegames.com | the addictive games | 2006-08-02 | 2026-08-02 | 20 | Dreamhost, Llc |
| chart-consulting.com | chart consulting | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| timberlakefurniture.com | timberlake furniture | 2006-08-04 | 2026-08-04 | 20 | Tirupati Domains And Hosting Pvt Ltd. |
| centerforplace.com | center for place | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| kiddspalace.com | kidds palace | 2006-08-02 | 2026-08-02 | 20 | Register.Com – Network Solutions, Llc |
| lessonsfromthings.com | lessons from things | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| florianenewton.com | floriane newton | 2006-08-03 | 2026-08-03 | 20 | Enom, Llc |
| 2sexphone.com | 2 sex phone | 2006-08-03 | 2026-08-03 | 20 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| suncheercap.com | sun cheer cap | 2006-08-15 | 2026-08-15 | 20 | Xin Net Technology Corporation |
| waibolaomu.com | wai bo lao mu | 2006-08-12 | 2026-08-12 | 20 | Bizcn.Com, Inc. |
| etudecarnot5.com | etude carnot 5 | 2007-01-12 | 2027-01-12 | 20 | Orange |
| miscuous.com | miscuous | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| magellanprint.com | magellan print | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| elegantlinencorp.com | elegant linen corp | 2006-08-03 | 2026-08-03 | 20 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| mrsegg.com | mrs egg | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| rogershealyismyrealtor.com | roger shealy is my realtor | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| crivanoterapiasorientais.com | crivano terapias orientais | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| clarecountylaw.com | clare county law | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| chillrollwalzen.com | chill roll walzen | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| labpractices.com | lab practices | 2006-09-18 | 2026-09-18 | 20 | Csc Corporate Domains, Inc. |
| amon-law.com | amon law | 2006-08-03 | 2026-08-03 | 20 | Wild West Domains, Llc |
| linexofkalispell.com | linex of kalispell | 2006-08-02 | 2026-08-02 | 20 | Network Solutions, Llc |
| rdurhamparks.com | r durham parks | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| coredecolombia.com | core de colombia | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| sunforet.com | sun foret | 2006-08-04 | 2026-08-04 | 20 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| golfclubrealestate.com | golf club real estate | 2006-08-02 | 2026-08-02 | 20 | Enom, Llc |
| fabtechsupply.com | fab tech supply | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| jinkehb.com | jin ke hb | 2006-08-13 | 2026-08-13 | 20 | Gname.Com Pte. Ltd. |
| dantrammell.com | dan trammell | 2006-08-04 | 2026-08-04 | 20 | GoDaddy |
| jachingale.com | jac hingale | 2006-09-28 | 2026-08-03 | 20 | GoDaddy |
| world-cast.com | world cast | 2006-08-01 | 2026-08-01 | 20 | United-Domains Gmbh |
| royalwashandlube.com | royal wash and lube | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| scarletaffair.com | scarlet affair | 2006-08-02 | 2026-08-02 | 20 | Annulet Llc |
| ballbalm.com | ball balm | 2006-08-02 | 2026-08-02 | 20 | Domain.Com – Network Solutions, Llc |
| nnnleaseforsale.com | nnn lease for sale | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| jeffmccannmusic.com | jeff mccann music | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| sanantoniogolfcoursedirectory.com | san antonio golf course directory | 2006-07-26 | 2026-08-02 | 20 | Epik Llc |
| postsbeam.com | posts beam | 2006-08-02 | 2026-08-02 | 20 | Annulet Llc |
| youngsvilleparksandrec.com | youngsville parks and rec | 2006-03-15 | 2026-08-04 | 20 | GoDaddy |
| fasterprogrammer.com | faster programmer | 2006-08-04 | 2026-08-04 | 20 | GoDaddy |
| creta-research.com | creta research | 2007-02-08 | 2027-02-08 | 20 | Registrygate Gmbh |
| bendbrewingbeer.com | bend brewing beer | 2006-08-13 | 2026-08-13 | 20 | Gname.Com Pte. Ltd. |
| wonderfulimages.com | wonderful images | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| flyingcarpetdesigns.com | flying carpet designs | 2006-08-04 | 2026-08-04 | 20 | GoDaddy |
| fillmorehighalumni.com | fillmore high alumni | 2006-08-04 | 2026-08-04 | 20 | GoDaddy |
| northeastautopa.com | northeast auto pa | 2006-08-02 | 2026-08-02 | 20 | Register.Com – Network Solutions, Llc |
| taxicabus.com | taxi cab us | 2006-09-13 | 2026-09-13 | 20 | GoDaddy |
| qualityluxurygoods.com | quality luxury goods | 2006-08-03 | 2026-08-03 | 20 | Enom, Llc |
| tvsetfree.com | tv set free | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| chill-roll.com | chill roll | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| chrisbrite.com | chris brite | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| usmanagedservices.com | us managed services | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| realestate1031.com | real estate 1031 | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| showersandbathroomsdirect.com | showers and bathrooms direct | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| szbls.com | sz bls | 2006-08-13 | 2026-08-13 | 20 | Gname.Com Pte. Ltd. |
| m-and-co.com | m and co | 2006-08-05 | 2026-08-05 | 20 | Web Commerce Communications Limited Dba Webnic.Cc |
| wwwservientrega.com | www servientrega | 2006-08-03 | 2026-08-03 | 20 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| mtypes.com | m types | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| hbksr.com | hbksr | 2006-08-06 | 2026-08-06 | 20 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| karmenmeyer.com | karmen meyer | 2006-08-05 | 2026-08-05 | 20 | Dynadot |
| litunfabrics.com | litun fabrics | 2006-08-04 | 2026-08-04 | 20 | Dynadot |
| asmonacofc.com | as monaco fc | 2006-11-04 | 2026-11-04 | 20 | GoDaddy |
| colleenlovett.com | colleen lovett | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| alc-cafe.com | alc cafe | 2006-08-03 | 2026-08-03 | 20 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| theworldaccordingtosuz.com | the world according to suz | 2006-09-28 | 2026-08-03 | 20 | GoDaddy |
| perimeca-font.com | perimeca font | 2007-04-23 | 2027-04-23 | 20 | Orange |
| pda315.com | pda 315 | 2006-08-15 | 2026-08-15 | 20 | Dnspod, Inc. |
| xn--ixaltc.com | xn--ixaltc | 2006-08-02 | 2026-08-02 | 20 | Epik Llc |
| chill-roll-walzen.com | chill roll walzen | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| toolbockx.com | tool bockx | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| mjpullins.com | mj pullins | 2006-08-03 | 2026-08-03 | 20 | Wild West Domains, Llc |
| nationwidebiweeklyadministration.com | nationwide biweekly administration | 2006-08-04 | 2026-08-04 | 20 | GoDaddy |
| tcaprep.com | tca prep | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| nuvolavillage.com | nuvola village | 2006-08-04 | 2026-08-04 | 20 | Tucows Domains Inc. |
| thetaoofdad.com | the tao of dad | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| mikeandcharlene.com | mike and charlene | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| jonesfamilytrees.com | jones family trees | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| identitysweeper.com | identity sweeper | 2007-02-06 | 2027-05-14 | 20 | GoDaddy |
| jurasudhand.com | jura sud hand | 2006-08-02 | 2026-08-02 | 20 | Network Solutions, Llc |
| jokes-news.com | jokes news | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| mayor360.com | mayor 360 | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| cash-creating-ideas.com | cash creating ideas | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| 1031program.com | 1031 program | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| trucaster.com | tru caster | 2006-09-18 | 2026-09-18 | 20 | Csc Corporate Domains, Inc. |
| all4youbooks.com | all 4 you books | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| eesoh-mis.com | eesoh mis | 2006-08-02 | 2026-08-02 | 20 | Network Solutions, Llc |
| dotnetlimitada.com | dot net limitada | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| pgconsultora.com | pg consultora | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| sanfranciscotherapycenter.com | san francisco therapy center | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| scchgg.com | scchgg | 2006-08-14 | 2026-08-14 | 20 | Hefei Juming Network Technology Co., Ltd |
| iracipackaging.com | iraci packaging | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| walkincoolersrus.com | walk in coolers r us | 2006-08-04 | 2026-08-04 | 20 | GoDaddy |
| kaytonlaw.com | kayton law | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| charlovett.com | charlovett | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| nevskyhotels.com | nevsky hotels | 2006-08-14 | 2026-08-14 | 20 | Registrator Domenov Llc |
| nashvillelawns.com | nashville lawns | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| ozturkkebab.com | ozturk kebab | 2006-08-03 | 2026-08-03 | 20 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| gifushaho-hp.com | gifu shaho hp | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| acrosysteme.com | acro systeme | 2006-08-05 | 2026-08-05 | 20 | Onlinenic, Inc. |
| crc-siam.com | crc siam | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| thespeights.com | the speights | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| glaettwalzen.com | glaett walzen | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| lendingtopics.com | lending topics | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| noahmathias.com | noah mathias | 2006-08-04 | 2026-08-04 | 20 | Domeneshop As Dba Domainnameshop.Com |
| alwardatthebeach.com | al ward at the beach | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| matchgarment.com | match garment | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| cr-s.com | cr s | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| brightmindsbookstore.com | bright minds bookstore | 2006-08-03 | 2026-08-03 | 20 | Wild West Domains, Llc |
| johnriccolo.com | john riccolo | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| reainternational.com | rea international | 2006-08-02 | 2026-08-02 | 20 | Annulet Llc |
| trainingcleveland.com | training cleveland | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| pressleyhenningsen.com | pressley henningsen | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| cema7.com | cema 7 | 2006-09-15 | 2026-09-15 | 20 | Orange |
| carpenterscross.com | carpenters cross | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| fiveslumprecords.com | five slump records | 2006-03-28 | 2026-08-03 | 20 | GoDaddy |
| selfinkingaddressstamps.com | self inking address stamps | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| vipsextelephone.com | vip sex telephone | 2006-08-03 | 2026-08-03 | 20 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| seomonger.com | seo monger | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| parkplatzsex-kontakte.com | parkplatz sex kontakte | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| lean2serve.com | lean 2 serve | 2006-08-03 | 2026-08-03 | 20 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| fotofroggy.com | foto froggy | 2006-07-13 | 2026-11-04 | 20 | GoDaddy |
| theurgyit.com | theurgy it | 2006-08-04 | 2026-08-04 | 20 | Turncommerce, Inc. Dba Namebright.Com |
| xn--48sv60bwlo.com | xn--48sv60bwlo | 2006-08-15 | 2026-08-15 | 20 | Xin Net Technology Corporation |
| alunaevent.com | aluna event | 2006-09-09 | 2026-09-09 | 20 | GoDaddy |
| dominicwall.com | dominic wall | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| mockingbirdobgyn.com | mockingbird obgyn | 2006-08-04 | 2026-08-04 | 20 | Tucows Domains Inc. |
| tecresponse.com | tec response | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| daviechilicookoff.com | davie chili cookoff | 2006-08-04 | 2026-08-04 | 20 | Tucows Domains Inc. |
| 51ayi.com | 51 ayi | 2006-08-04 | 2026-08-04 | 20 | Turncommerce, Inc. Dba Namebright.Com |
| edentalpracticefinancing.com | e dental practice financing | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| trainwashing.com | train washing | 2006-08-03 | 2026-08-03 | 20 | Wild West Domains, Llc |
| kentelmstennisclub.com | kent elms tennis club | 2006-08-03 | 2026-08-03 | 20 | Enom, Llc |
| glaett-walzen.com | glaett walzen | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| sydscolessides.com | syds coles sides | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| faq1031.com | faq 1031 | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| bathroomsandshowersdirect.com | bathrooms and showers direct | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| jmeweb.com | jme web | 2006-08-04 | 2026-08-04 | 20 | Turncommerce, Inc. Dba Namebright.Com |
| integrated-geosolutions.com | integrated geosolutions | 2006-08-02 | 2026-08-02 | 20 | Network Solutions, Llc |
| ravaysnow.com | ravay snow | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| wovenlabelsplus.com | woven labels plus | 2006-08-02 | 2026-08-02 | 20 | Network Solutions, Llc |
| photosby13.com | photos by 13 | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| private-website.com | private website | 2006-08-01 | 2026-08-01 | 20 | United-Domains Gmbh |
| ttdv43.com | ttdv 43 | 2006-12-22 | 2026-12-22 | 20 | Orange |
| rifleads.com | rif leads | 2006-08-02 | 2026-08-02 | 20 | Enom, Llc |
| urgentambulance.com | urgent ambulance | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| cheshireroofingllc.com | cheshire roofing llc | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| bakertradinggroup.com | baker trading group | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| afghannamzati.com | afghan namzati | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| grandprixhospitality.com | grand prix hospitality | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| napleshousebuyers.com | naples house buyers | 2006-11-05 | 2026-08-03 | 20 | GoDaddy |
| assurema-provence.com | assurema provence | 2007-01-30 | 2027-01-30 | 20 | Orange |
| mdbookkeepingdoctor.com | md bookkeeping doctor | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| mealdue.com | meal due | 2006-08-04 | 2026-08-04 | 20 | GoDaddy |
| tourinhand.com | tour in hand | 2006-08-13 | 2026-08-13 | 20 | Gname.Com Pte. Ltd. |
| tekresponse.com | tek response | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| johnrosa.com | john rosa | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| sandtint.com | sand tint | 2006-08-02 | 2026-08-02 | 20 | Register.Com – Network Solutions, Llc |
| ngochuyphoto.com | ngoc huy photo | 2006-08-10 | 2026-08-10 | 20 | P.A. Viet Nam Company Limited |
| capelle-ma.com | capelle ma | 2006-12-11 | 2026-12-11 | 20 | Orange |
| yanyalun.com | yan yalun | 2006-08-04 | 2026-08-04 | 20 | GoDaddy |
| de1host.com | de 1 host | 2006-08-08 | 2026-08-08 | 20 | Cnobin Information Technology Limited |
| gumbysfsu.com | gumby sfsu | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| pirolgmbh.com | pirol gmbh | 2007-05-16 | 2027-05-16 | 20 | Registrygate Gmbh |
| xixiangtang.com | xi xiang tang | 2006-08-06 | 2026-08-06 | 20 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| hebukesaier.com | he bu ke saier | 2006-08-06 | 2026-08-06 | 20 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| eventoblog.com | evento blog | 2006-08-03 | 2026-08-03 | 20 | Soluciones Corporativas Ip, Sl |
| portraitmachine.com | portrait machine | 2006-08-02 | 2026-08-02 | 20 | Sea Wasp, Llc |
| xn--80aanbassafynku9dj.com | xn--80aanbassafynku9dj | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| glenmorrison.com | glen morrison | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| darylfmoseleydds.com | daryl f moseley dds | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| irs1031tax.com | irs 1031 tax | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| thelupners.com | the lupners | 2006-08-02 | 2026-08-02 | 20 | Network Solutions, Llc |
| wolfgangmoser-idar.com | wolfgang moser idar | 2006-08-02 | 2026-08-02 | 20 | Ionos Se |
| conceptshealthcare.com | concepts healthcare | 2006-08-02 | 2026-08-02 | 20 | Annulet Llc |
| ambalavasi.com | ambalavasi | 2006-08-03 | 2026-08-03 | 20 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| hoomadesign.com | hooma design | 2006-08-14 | 2026-08-14 | 20 | Gname.Com Pte. Ltd. |
| symeonart.com | symeon art | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| sofiges-expert.com | sofiges expert | 2007-02-16 | 2027-02-16 | 20 | Orange |
| dosometalking.com | do some talking | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| illinois365.com | illinois 365 | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| letterkennybandb.com | letterkenny b and b | 2006-08-12 | 2026-08-12 | 20 | Register Spa |
| cfeitc-sz.com | cfeitc sz | 2006-08-15 | 2026-08-15 | 20 | Xin Net Technology Corporation |
| arringtonphotography.com | arrington photography | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| homehalfway.com | home halfway | 2006-08-04 | 2026-08-04 | 20 | Turncommerce, Inc. Dba Namebright.Com |
| bharathymatrimony.com | bharathy matrimony | 2006-08-03 | 2026-08-03 | 20 | Wild West Domains, Llc |
| alaskagoldenbear.com | alaska golden bear | 2006-08-05 | 2026-08-05 | 20 | NameSilo |
| bigmoviedicks.com | big movie dicks | 2006-08-02 | 2026-08-02 | 20 | Moniker Online Services Llc |
| xxxdvdeuro.com | xxx dvd euro | 2006-08-03 | 2026-08-03 | 20 | Dnc Holdings, Inc. |
| lucid-hawaii.com | lucid hawaii | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| vernsorensen.com | vern sorensen | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| vipsexcall.com | vip sex call | 2006-08-03 | 2026-08-03 | 20 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| daytonabeachtaxi.com | daytona beach taxi | 2006-09-13 | 2026-09-13 | 20 | GoDaddy |
| txarthritis.com | tx arthritis | 2006-08-03 | 2026-08-03 | 20 | Network Solutions, Llc |
| iliketattoos.com | i like tattoos | 2006-08-03 | 2026-08-03 | 20 | Namecheap |
| kanandro.com | kanandro | 2006-09-14 | 2026-09-14 | 20 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| thenightoftheiguana.com | the night of the iguana | 2006-08-03 | 2026-08-03 | 20 | GoDaddy |
| kkwmanagement.com | kkw management | 2006-08-02 | 2026-08-02 | 20 | Network Solutions, Llc |
| bigmat-perrey.com | bigmat perrey | 2007-01-05 | 2027-01-05 | 20 | Orange |
| christinebowers.com | christine bowers | 2006-08-03 | 2026-08-03 | 20 | Wild West Domains, Llc |
| veneerslumber.com | veneer slumber | 2006-08-02 | 2026-08-02 | 20 | Annulet Llc |
| biglerproductions.com | bigler productions | 2006-08-04 | 2026-08-04 | 20 | GoDaddy |
| kingstransportationgroup.com | kings transportation group | 2006-09-13 | 2026-09-13 | 20 | GoDaddy |
| peinturecaraibe.com | peinture caraibe | 2007-08-03 | 2026-08-03 | 19 | Ionos Se |
| tomcoroneos.com | tom coroneos | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| graduateprofessor.com | graduate professor | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| pdltoll.com | pdl toll | 2007-09-18 | 2026-09-18 | 19 | Csc Corporate Domains, Inc. |
| elocompany.com | elo company | 2007-08-03 | 2026-08-03 | 19 | Automattic Inc. |
| pantiespulleddown.com | panties pulled down | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| oslogladiators.com | oslo gladiators | 2007-08-04 | 2026-08-04 | 19 | Domeneshop As Dba Domainnameshop.Com |
| friendsoftheroundtable.com | friends of the roundtable | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| medicinecreekhuntinglodge.com | medicine creek hunting lodge | 2007-08-04 | 2026-08-04 | 19 | Tucows Domains Inc. |
| tomlindstromphotography.com | tom lindstrom photography | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| comprar-llogar.com | comprar llogar | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| mycustomskincare.com | my custom skincare | 2007-08-04 | 2026-08-04 | 19 | Tucows Domains Inc. |
| 12268.com | 12268 | 2007-08-02 | 2026-08-02 | 19 | Sea Wasp, Llc |
| knittedyarn.com | knitted yarn | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| korybenken.com | kory benken | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| adsdmagicdance.com | adsd magic dance | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| greenbrookhealthcare.com | green brook healthcare | 2007-08-03 | 2026-08-03 | 19 | Enom, Llc |
| szkzy.com | szkzy | 2007-08-03 | 2026-08-03 | 19 | Xiamen 35.Com Information Co., Ltd. |
| inucherry.com | inu cherry | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| addoralive.com | addor alive | 2007-08-02 | 2026-08-02 | 19 | Annulet Llc |
| youngbloodracing.com | youngblood racing | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| infonewsdaily.com | info news daily | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| steveannessa.com | steve annessa | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| htqzt.com | htqzt | 2007-08-13 | 2026-08-13 | 19 | Gname.Com Pte. Ltd. |
| shahmotel.com | shah motel | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| apanhadospt.com | apanhados pt | 2007-08-02 | 2026-08-02 | 19 | Network Solutions, Llc |
| w52w.com | w 52 w | 2007-08-13 | 2026-08-13 | 19 | Gname.Com Pte. Ltd. |
| partnersadmin.com | partners admin | 2007-07-14 | 2026-08-02 | 19 | Key-Systems Gmbh |
| 24specials.com | 24 specials | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| innovativetrophy.com | innovative trophy | 2007-08-02 | 2026-08-02 | 19 | Dreamhost, Llc |
| daytrading365.com | day trading 365 | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| esportscup.com | esports cup | 2007-09-15 | 2026-09-15 | 19 | Http.Net Internet Gmbh |
| website-directory-uk.com | website directory uk | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| cheesychelsea.com | cheesy chelsea | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| opillz.com | opillz | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| crabbypeoplesuck.com | crabby people suck | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| seikothailand.com | seiko thailand | 2007-08-04 | 2026-08-04 | 19 | Tucows Domains Inc. |
| sheehydatadesign.com | sheehy data design | 2007-08-02 | 2026-08-02 | 19 | Bluehost Inc. |
| reallybighugs.com | really big hugs | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| techfundoo.com | tech fundoo | 2007-08-03 | 2026-08-03 | 19 | Register.Com – Network Solutions, Llc |
| clubako.com | club ako | 2007-08-12 | 2026-08-12 | 19 | Register Spa |
| optionsetf.com | options etf | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| obsessionpill.com | obsession pill | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| rockbodyfitness.com | rock body fitness | 2007-08-02 | 2026-08-02 | 19 | Epik Llc |
| retailenergybank.com | retail energy bank | 2007-08-02 | 2026-08-02 | 19 | Hostopia Canada Corp |
| robesrus.com | robes r us | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| pse-th.com | pse th | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| famactech.com | famac tech | 2007-08-04 | 2026-08-04 | 19 | Tucows Domains Inc. |
| aurinkotupa.com | aurinko tupa | 2007-08-03 | 2026-08-03 | 19 | Realtime Register B.V. |
| las-faith.com | las faith | 2007-08-03 | 2026-08-03 | 19 | Xiamen 35.Com Information Co., Ltd. |
| bransonquiltstore.com | branson quilt store | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| myfixedpc.com | my fixed pc | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| fake-replica-longines-watches.com | fake replica longines watches | 2007-09-18 | 2026-09-18 | 19 | Csc Corporate Domains, Inc. |
| xn--nlqz1ub0as32m.com | xn--nlqz1ub0as32m | 2007-08-05 | 2026-08-05 | 19 | Dynadot |
| yiyinginc.com | yiying inc | 2007-08-06 | 2026-08-06 | 19 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| clevelandcollege.com | cleveland college | 2007-08-04 | 2026-08-04 | 19 | Domainclub.Com, Llc |
| okuno-dental.com | okuno dental | 2007-08-04 | 2026-08-04 | 19 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| xn--zcr33l2z4cfqf.com | xn--zcr33l2z4cfqf | 2007-08-05 | 2026-08-05 | 19 | Dynadot |
| benefitseventsmanager.com | benefits events manager | 2007-08-02 | 2026-08-02 | 19 | Enom, Llc |
| aparish.com | a parish | 2007-08-30 | 2026-08-30 | 19 | Orange |
| shibata-shounika.com | shibata shounika | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| groupeeolen.com | groupe eolen | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| tenerunsitio.com | tene run sitio | 2007-08-03 | 2026-08-03 | 19 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| bigtado.com | big tado | 2007-08-04 | 2026-08-04 | 19 | Tucows Domains Inc. |
| nearmissmedia.com | near miss media | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| lrrgp-huissierjustice.com | lrrgp huissier justice | 2008-06-24 | 2027-06-24 | 19 | Orange |
| myesoccer.com | my e soccer | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| mercedesgrandin.com | mercedes grandin | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| moshair.com | mos hair | 2007-08-03 | 2026-08-03 | 19 | Spaceship, Inc. |
| kbslove.com | kbs love | 2007-08-06 | 2026-08-06 | 19 | Gabia, Inc. |
| podelis.com | podelis | 2007-08-10 | 2026-08-10 | 19 | Regional Network Information Center, Jsc Dba Ru-Center |
| e-tresor.com | e tresor | 2007-08-02 | 2026-08-02 | 19 | Key-Systems Gmbh |
| cookouttonight.com | cookout tonight | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| novipizza.com | novi pizza | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| beatlotto.com | beat lotto | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| autorepairmanualsonline.com | auto repair manuals online | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| boniteau-bilski.com | boniteau bilski | 2008-04-23 | 2027-04-23 | 19 | Orange |
| huojia818.com | huo jia 818 | 2007-08-13 | 2026-08-13 | 19 | Gname.Com Pte. Ltd. |
| investmentmoves.com | investment moves | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| kellyharada.com | kelly harada | 2007-08-02 | 2026-08-02 | 19 | Register.Com – Network Solutions, Llc |
| yg-d.com | yg d | 2007-10-03 | 2026-10-03 | 19 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| sghfjt.com | sghfjt | 2007-08-14 | 2026-08-14 | 19 | Gname.Com Pte. Ltd. |
| sn-commodity.com | sn commodity | 2007-08-13 | 2026-08-13 | 19 | Gname.Com Pte. Ltd. |
| lumiere-apartments.com | lumiere apartments | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| securitychauffeur.com | security chauffeur | 2007-08-02 | 2026-08-02 | 19 | Network Solutions, Llc |
| shcva.com | shcva | 2007-08-14 | 2026-08-14 | 19 | Gname.Com Pte. Ltd. |
| goldistocks.com | gold i stocks | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| ginza-cc.com | ginza cc | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| redacrom.com | redacrom | 2007-08-04 | 2026-08-04 | 19 | Tucows Domains Inc. |
| testapill.com | testa pill | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| cpdevils.com | cp devils | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| avigant.com | avigant | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| insurancecoveragecounselnetwork.com | insurance coverage counsel network | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| ronaldwells.com | ronald wells | 2007-07-28 | 2026-08-05 | 19 | Dynadot |
| marbelladaytona.com | marbella daytona | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| todayshairdesigns.com | todays hair designs | 2007-11-04 | 2026-11-04 | 19 | GoDaddy |
| 6ahy.com | 6 ahy | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| 56206.com | 56206 | 2007-08-02 | 2026-08-02 | 19 | Sea Wasp, Llc |
| thisbagisgreen.com | this bag is green | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| expresslegalsupport.com | express legal support | 2007-08-03 | 2026-08-03 | 19 | Enom, Llc |
| floraglamor.com | flora glamor | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| godisee.com | go di see | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| rentpittsburg.com | rent pittsburg | 2007-08-02 | 2026-08-02 | 19 | Bluehost Inc. |
| rehobothhouse.com | rehoboth house | 2007-08-04 | 2026-08-04 | 19 | Dynadot |
| xn--fiqu2v0zay45i0ro.com | xn--fiqu2v0zay45i0ro | 2007-08-05 | 2026-08-05 | 19 | Dynadot |
| rhlcc.com | rhlcc | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| multimediaconverters.com | multimedia converters | 2007-08-13 | 2026-08-13 | 19 | Gname.Com Pte. Ltd. |
| atlante-ingenierie.com | atlante ingenierie | 2007-12-06 | 2026-12-06 | 19 | Orange |
| rangerpete.com | ranger pete | 2007-08-05 | 2026-08-05 | 19 | NameSilo |
| erdpg.com | erdpg | 2007-08-03 | 2026-08-03 | 19 | Wild West Domains, Llc |
| dbidentityfinder.com | db identity finder | 2008-04-23 | 2027-04-23 | 19 | GoDaddy |
| fake-replica-longines-watch.com | fake replica longines watch | 2007-09-18 | 2026-09-18 | 19 | Csc Corporate Domains, Inc. |
| pfalz-blog.com | pfalz blog | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| neonbayresort.com | neon bay resort | 2007-08-04 | 2026-08-04 | 19 | Dynadot |
| hlbtax.com | hlb tax | 2007-10-31 | 2026-11-05 | 19 | GoDaddy |
| newmexico1outfitter.com | new mexico 1 outfitter | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| free-glitter-graphic.com | free glitter graphic | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| reallybighug.com | really big hug | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| ekg4christ.com | ekg 4 christ | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| buydvctimeshare.com | buy dvc timeshare | 2007-09-12 | 2026-08-03 | 19 | Namecheap |
| shendada.com | shen da da | 2007-08-13 | 2026-08-13 | 19 | Gname.Com Pte. Ltd. |
| butlerpropertymanagement.com | butler property management | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| bogurus.com | bo gurus | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| lasvegasbonuses.com | las vegas bonuses | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| horizontalwelldrillers.com | horizontal well drillers | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| tombulum.com | tombulum | 2007-08-03 | 2026-08-03 | 19 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| ebakka.com | ebakka | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| gardenercatalogs.com | gardener catalogs | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| kalostherapeutics.com | kalos therapeutics | 2007-08-16 | 2026-09-13 | 19 | GoDaddy |
| peinturescaraibes.com | peintures caraibes | 2007-08-03 | 2026-08-03 | 19 | Ionos Se |
| milleniumpropertymanagement.com | millenium property management | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| positiveparentcoach.com | positive parent coach | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| lbjoutletfeedback.com | lbj outlet feedback | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| markus-krafft-frisuren.com | markus krafft frisuren | 2007-09-11 | 2026-09-11 | 19 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| wave-native.com | wave native | 2007-08-12 | 2026-08-12 | 19 | Register Spa |
| buythistrailer.com | buy this trailer | 2007-08-02 | 2026-08-02 | 19 | Porkbun Llc |
| xn--ruqr1rgt4cm3d.com | xn--ruqr1rgt4cm3d | 2007-08-05 | 2026-08-05 | 19 | Dynadot |
| strengthtrainingtips.com | strength training tips | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| intechnews.com | in tech news | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| cpdevil.com | cp devil | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| arcticclaim.com | arctic claim | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| boughtonfarm.com | boughton farm | 2007-08-03 | 2026-08-03 | 19 | Ionos Se |
| iriyamasa.com | iriyamasa | 2007-08-03 | 2026-08-03 | 19 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| godswordonthewall.com | gods word on the wall | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| imdoinggood.com | im doing good | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| 5starflorists.com | 5 star florists | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| avancecorpservices.com | avance corp services | 2007-05-18 | 2026-08-05 | 19 | NameSilo |
| giftandglory.com | gift and glory | 2007-10-10 | 2026-10-10 | 19 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| hstlst.com | hstlst | 2007-11-04 | 2026-11-04 | 19 | GoDaddy |
| bratsluts.com | brat sluts | 2007-08-05 | 2026-08-05 | 19 | NameSilo |
| bloggingfacts.com | blogging facts | 2008-12-21 | 2027-12-21 | 19 | GoDaddy |
| manontheground.com | man on the ground | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| david-rubenstein.com | david rubenstein | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| navy-lodges.com | navy lodges | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| d4project.com | d 4 project | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| palmspringslimoandcarservice.com | palm springs limo and car service | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| yokoteumaimon.com | yokote umaimon | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| easyresaledvc.com | easy resale dvc | 2007-07-19 | 2026-08-03 | 19 | Namecheap |
| hbmulticooker.com | hb multicooker | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| epollsurvey.com | e poll survey | 2007-08-04 | 2026-08-04 | 19 | Above.Com Pty Ltd. |
| sportshealthclub.com | sports health club | 2007-08-04 | 2026-08-04 | 19 | NameSilo |
| thesqlsource.com | the sql source | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| romchatra.com | rom chatra | 2007-08-05 | 2026-08-05 | 19 | Web Commerce Communications Limited Dba Webnic.Cc |
| diy-inspiration.com | diy inspiration | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| gaosuconsult.com | gao su consult | 2007-08-13 | 2026-08-13 | 19 | Gname.Com Pte. Ltd. |
| florale-geschenkideen.com | florale geschenkideen | 2007-08-01 | 2026-08-01 | 19 | Mesh Digital Limited |
| seasidemindbody.com | seaside mind body | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| oceanbluebeach.com | ocean blue beach | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| lepage-verger.com | lepage verger | 2008-02-13 | 2027-02-13 | 19 | Orange |
| townofyoungsville.com | town of youngsville | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| herndonjiujitsu.com | herndon jiujitsu | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| midlyricphotography.com | mid lyric photography | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| monkeybutlercomedy.com | monkey butler comedy | 2007-09-24 | 2026-09-12 | 19 | GoDaddy |
| greenwayinspections.com | greenway inspections | 2007-08-02 | 2026-08-02 | 19 | Moniker Online Services Llc |
| muehlenfreunde.com | muehlen freunde | 2008-07-24 | 2027-07-24 | 19 | Internetx Gmbh |
| guardscarpetcleaning.com | guards carpet cleaning | 2007-08-03 | 2026-08-03 | 19 | 123-Reg Limited |
| sheliayoungblood.com | shelia youngblood | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| waterforlocalfarms.com | water for local farms | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| wasatchmountainvizslas.com | wasatch mountain vizslas | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| peaseclub.com | pease club | 2007-08-02 | 2026-08-02 | 19 | Kagoya Japan Inc. |
| nemafinancial.com | nema financial | 2007-08-02 | 2026-08-02 | 19 | Hostopia Canada Corp |
| coiryarn.com | coir yarn | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| socialwebnews.com | social web news | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| capgeminishop.com | capgemini shop | 2007-08-03 | 2026-08-03 | 19 | Realtime Register B.V. |
| cruisebaryumbo.com | cruise bar yumbo | 2007-08-01 | 2026-08-01 | 19 | Domain.Com – Network Solutions, Llc |
| geriatricprogram.com | geriatric program | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| dknyjoutletfeedback.com | dknyj outlet feedback | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| kanarashop.com | kanara shop | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| anadolukroseta.com | anadolu kroseta | 2007-08-02 | 2026-08-02 | 19 | İSimtescil Bilişim A.Ş. |
| bulgariaetf.com | bulgaria etf | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| antmforum.com | antm forum | 2007-08-03 | 2026-08-03 | 19 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| denismichaelreidy.com | denis michael reidy | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| haripatti.com | hari patti | 2007-08-03 | 2026-08-03 | 19 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| onlineaudiologyservices.com | online audiology services | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| identityfindersoftware.com | identity finder software | 2008-01-03 | 2027-05-14 | 19 | GoDaddy |
| eventosmagalhaes.com | eventos magalhaes | 2007-08-03 | 2026-08-03 | 19 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| fivestarflorist.com | five star florist | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| ddgonzo.com | dd gonzo | 2008-04-04 | 2027-04-04 | 19 | Hetzner Online Gmbh |
| cycliata.com | cycliata | 2007-08-02 | 2026-08-02 | 19 | Bluehost Inc. |
| militarywiki.com | military wiki | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| horsesbyjake.com | horses by jake | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| lastchanceairfares.com | last chance airfares | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| kazsmainstreetgarage.com | kazs main street garage | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| markus-krafft.com | markus krafft | 2007-09-11 | 2026-09-11 | 19 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| sunnysmagickitchen.com | sunnys magic kitchen | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| thorstenboesch.com | thorsten boesch | 2007-08-02 | 2026-08-02 | 19 | Hostopia Canada Corp |
| megabonusbingo.com | mega bonus bingo | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| razortoolbars.com | razor toolbars | 2007-08-03 | 2026-08-03 | 19 | Wild West Domains, Llc |
| abeautifulaffair.com | a beautiful affair | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| fakebones.com | fake bones | 2007-08-02 | 2026-08-02 | 19 | Sea Wasp, Llc |
| diamondahunting.com | diamond a hunting | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| cambodiaetf.com | cambodia etf | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| wovenmaterial.com | woven material | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| superphonegermany.com | super phone germany | 2007-08-03 | 2026-08-03 | 19 | Enom, Llc |
| 4along.com | 4 along | 2007-08-13 | 2026-08-13 | 19 | Gname.Com Pte. Ltd. |
| casimirforce.com | casimir force | 2007-08-04 | 2026-08-04 | 19 | GoDaddy |
| emmanuel-akermann.com | emmanuel akermann | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| italianmadeeasy.com | italian made easy | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| groupe-eolen.com | groupe eolen | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| viton-online.com | viton online | 2007-12-20 | 2026-12-20 | 19 | GoDaddy |
| zhuihuai.com | zhui huai | 2007-08-01 | 2026-08-01 | 19 | Chengdu West Dimension Digital Technology Co., Ltd. |
| joehammerstone.com | joe hammerstone | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| novoastudio.com | novoa studio | 2007-08-05 | 2026-08-05 | 19 | Dinahosting S.L. |
| circlebarhunting.com | circle bar hunting | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| chileetf.com | chile etf | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| cambriasoapworks.com | cambria soap works | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| fireninewebdesign.com | fire nine web design | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| steveaust.com | steve aust | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| shoenberger-shoenberger.com | shoenberger shoenberger | 2007-08-03 | 2026-08-03 | 19 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| dbs-uk.com | dbs uk | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| chinagan.com | china gan | 2007-08-14 | 2026-08-14 | 19 | Gname.Com Pte. Ltd. |
| jcoutletfeedback.com | jc outlet feedback | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| shopmarais.com | shop marais | 2007-08-02 | 2026-08-02 | 19 | Network Solutions, Llc |
| sisalfiber.com | sisal fiber | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| vegassmallbusiness.com | vegas small business | 2007-08-03 | 2026-08-03 | 19 | Wild West Domains, Llc |
| malerbetrieb-canaletto.com | malerbetrieb canaletto | 2007-09-13 | 2026-09-13 | 19 | Ionos Se |
| collectiveperspectivecounseling.com | collective perspective counseling | 2007-08-04 | 2026-08-04 | 19 | Tucows Domains Inc. |
| insultantforhire.com | insultant for hire | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| babydigi.com | baby digi | 2007-08-06 | 2026-08-06 | 19 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| coconutfibers.com | coconut fibers | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| glenbarnhardt.com | glen barnhardt | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| diyinspiration.com | diy inspiration | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| wwwmakaan.com | www makaan | 2007-08-04 | 2026-08-04 | 19 | NameSilo |
| prefaconstrucciones.com | prefa construcciones | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| fkm-online.com | fkm online | 2008-01-14 | 2027-01-14 | 19 | GoDaddy |
| coirrope.com | coir rope | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| ksoutletfeedback.com | ks outlet feedback | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| geekzmo.com | geekzmo | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| snowsick.com | snow sick | 2007-09-11 | 2026-09-11 | 19 | Corehub, S.R.L. |
| sofia-auto.com | sofia auto | 2008-04-21 | 2027-04-21 | 19 | Orange |
| riohondolandandcattlecompany.com | rio hondo land and cattle company | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| julianleidman.com | julian leidman | 2007-08-03 | 2026-08-03 | 19 | Network Solutions, Llc |
| minx-mode.com | minx mode | 2007-09-18 | 2026-09-18 | 19 | Hetzner Online Gmbh |
| benefiteventsmanager.com | benefit events manager | 2007-08-02 | 2026-08-02 | 19 | Enom, Llc |
| babegoods.com | babe goods | 2007-08-04 | 2026-08-04 | 19 | Turncommerce, Inc. Dba Namebright.Com |
| maraisdesigns.com | marais designs | 2007-08-02 | 2026-08-02 | 19 | Network Solutions, Llc |
| jngcqp.com | jngcqp | 2007-08-13 | 2026-08-13 | 19 | Gname.Com Pte. Ltd. |
| christianinspirationart.com | christian inspiration art | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| epistec.com | epistec | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| walterboucher.com | walter boucher | 2007-08-03 | 2026-08-03 | 19 | Wild West Domains, Llc |
| markuskrafft.com | markus krafft | 2007-09-11 | 2026-09-11 | 19 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| wovengeotextiles.com | woven geotextiles | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| fakebone.com | fake bone | 2007-08-02 | 2026-08-02 | 19 | Sea Wasp, Llc |
| eolengroupe.com | eolen groupe | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| sursansar.com | sur sansar | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| eolen-groupe.com | eolen groupe | 2007-08-02 | 2026-08-02 | 19 | Ionos Se |
| leverpointmgt.com | leverpoint mgt | 2007-08-02 | 2026-08-02 | 19 | Network Solutions, Llc |
| healthyhearingadvice.com | healthy hearing advice | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| fiberrug.com | fiber rug | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| instantfuneralpoems.com | instant funeral poems | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| hoodslang.com | hood slang | 2007-11-04 | 2026-11-04 | 19 | GoDaddy |
| coirrug.com | coir rug | 2007-08-03 | 2026-08-03 | 19 | GoDaddy |
| tatainformatica.com | tata informatica | 2007-08-03 | 2026-08-03 | 19 | Namecheap |
| benefiteventmanager.com | benefit event manager | 2007-08-02 | 2026-08-02 | 19 | Enom, Llc |
| suburbanvixen.com | suburban vixen | 2008-08-04 | 2026-08-04 | 18 | Tucows Domains Inc. |
| logisticamultigroupe.com | logistica multigroupe | 2008-08-02 | 2026-08-02 | 18 | Register.Com – Network Solutions, Llc |
| nmbtyy.com | nmbtyy | 2008-08-13 | 2026-08-13 | 18 | Gname.Com Pte. Ltd. |
| lsbaicha.com | ls baicha | 2008-08-14 | 2026-08-14 | 18 | Gname.Com Pte. Ltd. |
| hymendate.com | hymen date | 2008-08-21 | 2026-08-21 | 18 | Safenames Ltd. |
| vilaleopoldina.com | vila leopoldina | 2008-08-04 | 2026-08-04 | 18 | Turncommerce, Inc. Dba Namebright.Com |
| dcmarketingreport.com | dc marketing report | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| frontpage-to-expression.com | front page to expression | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| stevencattministries.com | steven catt ministries | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| napalaihospital.com | napalai hospital | 2008-08-05 | 2026-08-05 | 18 | Onlinenic, Inc. |
| ogr8one.com | ogr 8 one | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| doityourselflivingwill.com | do it yourself living will | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| kibelavet.com | kibelavet | 2008-08-10 | 2026-08-10 | 18 | Regional Network Information Center, Jsc Dba Ru-Center |
| bergs-online.com | bergs online | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| bdsm-berlin.com | bdsm berlin | 2008-10-04 | 2026-10-04 | 18 | Key-Systems Gmbh |
| eastlandmultimedia.com | eastland multimedia | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| drsharrie.com | dr sharrie | 2008-11-04 | 2026-11-04 | 18 | GoDaddy |
| locksgarage.com | locks garage | 2008-08-04 | 2026-08-04 | 18 | Easyspace Limited |
| bloglogodesign.com | blog logo design | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| donovanwatson.com | donovan watson | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| 08yw.com | 08yw | 2008-08-15 | 2026-08-15 | 18 | Xin Net Technology Corporation |
| trisonsolutions.com | trison solutions | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| jaeger-sas.com | jaeger sas | 2009-04-21 | 2027-04-21 | 18 | Orange |
| jilinguke.com | ji ling uke | 2008-08-13 | 2026-08-13 | 18 | Gname.Com Pte. Ltd. |
| mitiafrica.com | miti africa | 2008-08-03 | 2026-08-03 | 18 | Name Srs Ab |
| campbelloutlet.com | campbell outlet | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| stonextreme.com | ston extreme | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| jixiba.com | ji xi ba | 2008-08-15 | 2026-08-15 | 18 | Xin Net Technology Corporation |
| collegemiser.com | college miser | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| bingobigtop.com | bingo big top | 2008-08-11 | 2026-08-11 | 18 | Register Spa |
| kdiblog.com | kdi blog | 2009-05-27 | 2027-05-27 | 18 | Orange |
| firescott.com | fire scott | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| luppinodesign.com | luppino design | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| ogp-paris.com | ogp paris | 2008-11-06 | 2026-11-06 | 18 | Orange |
| exitsignsstore.com | exit signs store | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| ethancoledesigns.com | ethan cole designs | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| gulleyremodeling.com | gulley remodeling | 2008-08-02 | 2026-08-02 | 18 | Domain.Com – Network Solutions, Llc |
| tptsmartin.com | tpt smartin | 2009-01-14 | 2027-01-14 | 18 | Orange |
| leavedividendmiles.com | leave dividend miles | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| gdpol.com | gdpol | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| produitchasseetpeche.com | produit chasse et peche | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| lanseragroup.com | lansera group | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| ride-texastrip.com | ride texas trip | 2008-08-01 | 2026-08-01 | 18 | United-Domains Gmbh |
| djalrandi.com | dj alrandi | 2008-08-03 | 2026-08-03 | 18 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| preferredglassco.com | preferred glass co | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| induprotec.com | indu protec | 2008-08-14 | 2026-08-14 | 18 | Netearth One Inc. D/B/A Netearth |
| cherimittermaier.com | cheri mittermaier | 2008-11-04 | 2026-11-04 | 18 | GoDaddy |
| ever-games.com | ever games | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| augustarden.com | august arden | 2008-08-02 | 2026-08-02 | 18 | Dreamhost, Llc |
| aishwaryahome.com | aishwarya home | 2008-08-02 | 2026-08-02 | 18 | Ionos Se |
| mikesprivatescubalessons.com | mikes private scuba lessons | 2008-08-03 | 2026-08-03 | 18 | Enom, Llc |
| teresatanzi.com | teresa tanzi | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| soulshop-tattoo.com | soul shop tattoo | 2008-08-01 | 2026-08-01 | 18 | Domain Science Kutatási Szolgáltató Korlátolt Felelősségű Társaság |
| noahsplacepreschool.com | noahs place preschool | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| remontavto.com | remont avto | 2008-08-09 | 2026-08-09 | 18 | Regional Network Information Center, Jsc Dba Ru-Center |
| gzfuzhen.com | gz fu zhen | 2008-08-14 | 2026-08-14 | 18 | Gname.Com Pte. Ltd. |
| parkermustgo.com | parker must go | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| yinisi.com | yin isi | 2008-08-06 | 2026-08-06 | 18 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| vinapec.com | vina pec | 2008-08-04 | 2026-08-04 | 18 | Tucows Domains Inc. |
| samesexmarriagecertificate.com | same sex marriage certificate | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| gailhaun.com | gail haun | 2008-01-31 | 2026-08-03 | 18 | GoDaddy |
| tim-chan.com | tim chan | 2008-08-02 | 2026-08-02 | 18 | Enom, Llc |
| larryetterinc.com | larry etter inc | 2008-08-02 | 2026-08-02 | 18 | Bluehost Inc. |
| leavedm.com | leave dm | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| manacaeventos.com | manaca eventos | 2008-08-04 | 2026-08-04 | 18 | Tucows Domains Inc. |
| killusairways.com | kill us airways | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| roaringforkdental.com | roaring fork dental | 2008-08-03 | 2026-08-03 | 18 | Dnc Holdings, Inc. |
| kingrestaurantequipment.com | king restaurant equipment | 2008-11-04 | 2026-11-04 | 18 | GoDaddy |
| buongrande.com | buon grande | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| fultoncountyschool.com | fulton county school | 2008-08-04 | 2026-08-04 | 18 | NameSilo |
| lorealcarrer.com | loreal carrer | 2008-09-15 | 2026-09-15 | 18 | Nameshield Sas |
| cleanmender.com | clean mender | 2009-08-03 | 2027-08-04 | 18 | GoDaddy |
| sisoll.com | sisoll | 2008-08-12 | 2026-08-12 | 18 | Bizcn.Com, Inc. |
| spyrogon.com | spyrogon | 2008-08-12 | 2026-08-12 | 18 | Register Spa |
| porntang.com | porn tang | 2008-08-02 | 2026-08-02 | 18 | Network Solutions, Llc |
| annsswimclasses.com | anns swim classes | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| badai-intl.com | badai intl | 2008-08-05 | 2026-08-05 | 18 | Web Commerce Communications Limited Dba Webnic.Cc |
| synergysoberhouse.com | synergy sober house | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| ivanholguin.com | ivan holguin | 2008-08-05 | 2026-08-05 | 18 | Neubox Internet S.A. De C.V. |
| bandbgreenhouse.com | b and b greenhouse | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| uhdmonitors.com | uhd monitors | 2008-08-04 | 2026-08-04 | 18 | Turncommerce, Inc. Dba Namebright.Com |
| rovecybergate.com | rove cyber gate | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| netze-planen.com | netze planen | 2009-02-25 | 2027-02-25 | 18 | Mesh Digital Limited |
| saveusairways.com | save us airways | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| palmbeachprinting.com | palm beach printing | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| itinerantgolf.com | itinerant golf | 2008-04-08 | 2026-08-03 | 18 | GoDaddy |
| imagenplena.com | imagen plena | 2008-08-02 | 2026-08-02 | 18 | Hostinger Operations, Uab |
| qianluda.com | qian lu da | 2008-08-13 | 2026-08-13 | 18 | Gname.Com Pte. Ltd. |
| katrinakaifhome.com | katrina kaif home | 2008-08-02 | 2026-08-02 | 18 | Ionos Se |
| kuyou-system.com | kuyou system | 2009-06-17 | 2027-06-17 | 18 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| beauty-at-zest.com | beauty at zest | 2008-08-03 | 2026-08-03 | 18 | 123-Reg Limited |
| pmchallettsville.com | pmc hallettsville | 2008-08-05 | 2026-08-05 | 18 | NameSilo |
| juluba.com | juluba | 2008-08-15 | 2026-08-15 | 18 | Xin Net Technology Corporation |
| hogarthgsg.com | hogarth gsg | 2008-09-18 | 2026-09-18 | 18 | Csc Corporate Domains, Inc. |
| centerstagetexas.com | center stage texas | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| kandilalriyadh.com | kandil al riyadh | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| produitsnautiques.com | produits nautiques | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| slickflight.com | slick flight | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| angelotflooring.com | angelo t flooring | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| qiheba.com | qi he ba | 2008-08-15 | 2026-08-15 | 18 | Xin Net Technology Corporation |
| payminutes.com | pay minutes | 2008-08-18 | 2026-08-18 | 18 | Ionos Se |
| wootthereitis.com | woot there it is | 2008-08-04 | 2026-08-04 | 18 | NameSilo |
| sonarghare.com | sonar ghare | 2008-08-03 | 2026-08-03 | 18 | Bigrock Solutions Ltd. |
| yamasaki-ph.com | yamasaki ph | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| 9275333.com | 9275333 | 2008-08-05 | 2026-08-05 | 18 | Cloudflare, Inc. |
| nocarbonhere.com | no carbon here | 2008-08-02 | 2026-08-02 | 18 | Key-Systems Gmbh |
| dajiamai.com | da jia mai | 2008-08-03 | 2026-08-03 | 18 | Spaceship, Inc. |
| hezeba.com | he ze ba | 2008-08-15 | 2026-08-15 | 18 | Xin Net Technology Corporation |
| satyakammusic.com | satyakam music | 2008-08-04 | 2026-08-04 | 18 | Dynadot |
| upstreamconstructioninc.com | upstream construction inc | 2008-08-04 | 2026-08-04 | 18 | Namespro Solutions Inc. |
| treadstonep.com | treadstone p | 2008-08-04 | 2026-08-04 | 18 | Tucows Domains Inc. |
| gettrightworld.com | gett right world | 2008-08-02 | 2026-08-02 | 18 | Bluehost Inc. |
| aeganjang.com | ae gan jang | 2008-08-04 | 2026-08-04 | 18 | Megazone Corp., Dba Hosting.Kr |
| wwwlycamobile.com | www lycamobile | 2008-08-05 | 2026-08-05 | 18 | NameSilo |
| thetullygirls.com | the tully girls | 2008-08-04 | 2026-08-04 | 18 | Turncommerce, Inc. Dba Namebright.Com |
| parstc.com | parstc | 2008-08-03 | 2026-08-03 | 18 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| danymanuel.com | dany manuel | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| agenaconsulting.com | agena consulting | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| seoboutiques.com | seo boutiques | 2009-08-03 | 2027-08-04 | 18 | GoDaddy |
| olympic49er.com | olympic 49er | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| starwebdirectory.com | star web directory | 2008-08-13 | 2026-08-13 | 18 | Gname.Com Pte. Ltd. |
| doityourselfhealthcarepowerofattorney.com | do it yourself health care power of attorney | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| thesuburbanvixen.com | the suburban vixen | 2008-08-04 | 2026-08-04 | 18 | Tucows Domains Inc. |
| profilsetsystemes.com | profils et systemes | 2009-07-23 | 2027-07-23 | 18 | Orange |
| mamyology.com | mamy ology | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| gannex.com | gannex | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| kinheimfiltration.com | kinheim filtration | 2008-09-15 | 2026-09-15 | 18 | Metaregistrar Bv |
| yuqinge.com | yu qing e | 2008-08-14 | 2026-08-14 | 18 | Gname.Com Pte. Ltd. |
| dieorama.com | die orama | 2008-08-03 | 2026-08-03 | 18 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| velocecompany.com | veloce company | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| fireloadmedia.com | fire load media | 2008-08-02 | 2026-08-02 | 18 | Ionos Se |
| winecellarvisions.com | wine cellar visions | 2008-08-02 | 2026-08-02 | 18 | Register.Com – Network Solutions, Llc |
| liujinxin.com | liu jin xin | 2008-08-04 | 2026-08-04 | 18 | Dynadot |
| nmcyln.com | nmcyln | 2008-08-13 | 2026-08-13 | 18 | Gname.Com Pte. Ltd. |
| lunexor.com | lunexor | 2008-09-18 | 2026-09-18 | 18 | Csc Corporate Domains, Inc. |
| themadsci.com | the mad sci | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| ugonnaeatthat.com | u gonna eat that | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| nibusinessdirectory.com | ni business directory | 2008-08-01 | 2026-08-01 | 18 | Mesh Digital Limited |
| chairmangovforum.com | chairman gov forum | 2008-08-02 | 2026-08-02 | 18 | Bluehost Inc. |
| premiervideoandpizza.com | premier video and pizza | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| channeljournal.com | channel journal | 2008-08-02 | 2026-08-02 | 18 | Sea Wasp, Llc |
| wuanba.com | wuan ba | 2008-08-15 | 2026-08-15 | 18 | Xin Net Technology Corporation |
| t2amo.com | t2 amo | 2008-09-22 | 2026-09-22 | 18 | Orange |
| rotlicht-fuehrer.com | rotlicht fuehrer | 2008-08-02 | 2026-08-02 | 18 | 1Api Gmbh |
| leaveusairways.com | leave us airways | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| gsjnw.com | gsjnw | 2008-08-13 | 2026-08-13 | 18 | Gname.Com Pte. Ltd. |
| xiefuw.com | xie fu w | 2008-08-04 | 2026-08-04 | 18 | Dynadot |
| serenitynews.com | serenity news | 2008-08-02 | 2026-08-02 | 18 | Enom, Llc |
| londonlondonuk.com | london london uk | 2008-08-04 | 2026-08-04 | 18 | NameSilo |
| mystarterwife.com | my starter wife | 2008-08-20 | 2026-08-20 | 18 | Safenames Ltd. |
| geneion.com | geneion | 2008-08-05 | 2026-08-05 | 18 | NameSilo |
| straitphotography.com | strait photography | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| rutiling.com | rutiling | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| okulpanosu.com | okul panosu | 2008-08-02 | 2026-08-02 | 18 | İSimtescil Bilişim A.Ş. |
| inflammacorp.com | inflamma corp | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| drjohnoreilly.com | dr john oreilly | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| dickwaite.com | dick waite | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| beauty-zest.com | beauty zest | 2008-08-03 | 2026-08-03 | 18 | 123-Reg Limited |
| brianandjuliane.com | brian and juliane | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| lsboticket.com | lsbo ticket | 2008-08-03 | 2026-08-03 | 18 | 123-Reg Limited |
| scanner-animalia.com | scanner animalia | 2009-03-24 | 2027-03-24 | 18 | Orange |
| iroutlet.com | ir outlet | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| groupe-ps.com | groupe ps | 2009-07-22 | 2027-07-22 | 18 | Orange |
| tweea.com | tweea | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| y73bug.com | y 73 bug | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| aceventurez.com | ace venturez | 2008-08-03 | 2026-08-03 | 18 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| pyramidsofbosnia.com | pyramids of bosnia | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| theperilsofcyber-dating.com | the perils of cyber dating | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| asahi-izu.com | asahi izu | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| pola-czeskydays.com | pola czesky days | 2008-08-04 | 2026-08-04 | 18 | Tucows Domains Inc. |
| wulihu.com | wu li hu | 2008-08-15 | 2026-08-15 | 18 | Xin Net Technology Corporation |
| generacoutlet.com | generac outlet | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| juliannemadrin.com | julianne madrin | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| chiropracticmarketingguidebook.com | chiropractic marketing guidebook | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| mergiage.com | mergiage | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| artmanacor.com | art manacor | 2008-08-05 | 2026-08-05 | 18 | Dinahosting S.L. |
| theseocode.com | the seo code | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| shermansheet.com | sherman sheet | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| gestionyperitacion.com | gestion y peritacion | 2008-08-12 | 2026-08-12 | 18 | Nominalia Internet S.L. |
| mts365.com | mts 365 | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| incomegorilla.com | income gorilla | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| shangqiu360.com | shangqiu 360 | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| ruofanracing.com | ruofan racing | 2008-08-13 | 2026-08-13 | 18 | Gname.Com Pte. Ltd. |
| hcshengwu.com | hc sheng wu | 2008-08-13 | 2026-08-13 | 18 | Gname.Com Pte. Ltd. |
| firescottkirby.com | fire scott kirby | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| silonder.com | silonder | 2008-08-11 | 2026-08-11 | 18 | Jiangsu Bangning Science & Technology Co. Ltd. |
| dl1998.com | dl 1998 | 2008-08-13 | 2026-08-13 | 18 | Gname.Com Pte. Ltd. |
| zebrasoma.com | zebrasoma | 2009-03-03 | 2027-03-03 | 18 | Orange |
| apinchofthisapinchofthat.com | a pinch of this a pinch of that | 2008-08-04 | 2026-08-04 | 18 | Tucows Domains Inc. |
| yaniktedavi.com | yanik tedavi | 2008-09-01 | 2026-09-01 | 18 | Turkticaret.Net Yazılım Hizmetleri Sanayi Ve Ticaret A.Ş. |
| marcelaamato.com | marcela amato | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| thongdiep.com | thong diep | 2008-08-01 | 2026-08-01 | 18 | Name.Com, Inc. |
| camlipano.com | camlipano | 2008-08-02 | 2026-08-02 | 18 | İSimtescil Bilişim A.Ş. |
| minicoursesondemand.com | mini courses on demand | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| ffs-suport.com | ffs suport | 2008-08-04 | 2026-08-04 | 18 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| austriaconsulting.com | austria consulting | 2009-07-03 | 2027-07-03 | 18 | The Registrar Company B.V. |
| maineenterprises.com | maine enterprises | 2008-08-04 | 2026-08-04 | 18 | Turncommerce, Inc. Dba Namebright.Com |
| firekirby.com | fire kirby | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| ladyboy-paris.com | ladyboy paris | 2008-08-04 | 2026-08-04 | 18 | NameSilo |
| myciaa.com | my ciaa | 2008-08-13 | 2026-08-13 | 18 | Hefei Juming Network Technology Co., Ltd |
| anaal3b.com | ana al 3b | 2008-09-16 | 2026-09-16 | 18 | Key-Systems Gmbh |
| easternlax.com | eastern lax | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| hwcfc.com | hwcfc | 2008-08-03 | 2026-08-03 | 18 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| yaxika.com | yaxika | 2008-08-15 | 2026-08-15 | 18 | Xin Net Technology Corporation |
| nu-instruments.com | nu instruments | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| xmzhongmei.com | xm zhong mei | 2008-08-13 | 2026-08-13 | 18 | Gname.Com Pte. Ltd. |
| discountcomputersstore.com | discount computers store | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| loshanhora.com | los han hora | 2008-08-02 | 2026-08-02 | 18 | Ionos Se |
| lateste-primeurs.com | lateste primeurs | 2008-12-26 | 2026-12-26 | 18 | Orange |
| alpen-pension.com | alpen pension | 2008-08-05 | 2026-08-05 | 18 | Dynadot |
| firedougparker.com | fire doug parker | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| wuheba.com | wu he ba | 2008-08-15 | 2026-08-15 | 18 | Xin Net Technology Corporation |
| retrobabypatterns.com | retro baby patterns | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| buyingbestbrands.com | buying best brands | 2008-08-03 | 2026-08-03 | 18 | Spaceship, Inc. |
| chainedtothepump.com | chained to the pump | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| jp-note.com | jp note | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| iheartmyhair.com | i heart my hair | 2009-10-19 | 2027-10-19 | 18 | GoDaddy |
| preferred-properties.com | preferred properties | 2008-08-04 | 2026-08-04 | 18 | Dynadot |
| iconherb.com | icon herb | 2008-08-04 | 2026-08-04 | 18 | Wild West Domains, Llc |
| profils-et-systemes.com | profils et systemes | 2009-07-23 | 2027-07-23 | 18 | Orange |
| readypacs.com | ready pacs | 2008-08-03 | 2026-08-03 | 18 | Ionos Se |
| dcmarketingnewsletter.com | dc marketing newsletter | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| cegef-rechard.com | cegef rechard | 2009-04-29 | 2027-04-29 | 18 | Orange |
| jaelvelasco.com | jael velasco | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| mya2i.com | my a2i | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| sallydunnedaycare.com | sally dunne daycare | 2008-08-04 | 2026-08-04 | 18 | Tucows Domains Inc. |
| megarsa.com | megarsa | 2008-09-30 | 2026-08-03 | 18 | GoDaddy |
| illinoisbusinessvotes.com | illinois business votes | 2008-09-18 | 2026-09-18 | 18 | Csc Corporate Domains, Inc. |
| linkexchangetracker.com | link exchange tracker | 2008-08-04 | 2026-08-04 | 18 | NameSilo |
| therosenthalwebsite.com | the rosenthal website | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| omg-glass.com | omg glass | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| chrisdowney1.com | chris downey 1 | 2008-08-04 | 2026-08-04 | 18 | GoDaddy |
| axjljt.com | axjljt | 2008-08-14 | 2026-08-14 | 18 | Gname.Com Pte. Ltd. |
| cma-aude.com | cma aude | 2009-01-16 | 2027-01-16 | 18 | Orange |
| justforemails.com | just for emails | 2008-08-01 | 2026-08-01 | 18 | United-Domains Gmbh |
| febtonline.com | febt online | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| bossbearings.com | boss bearings | 2008-08-04 | 2026-08-04 | 18 | Above.Com Pty Ltd. |
| pumeditores.com | pum editores | 2009-02-16 | 2027-02-16 | 18 | GoDaddy |
| schuhe-onlineshop.com | schuhe onlineshop | 2008-10-07 | 2026-10-07 | 18 | Registrygate Gmbh |
| presentingyourpoint.com | presenting your point | 2008-08-03 | 2026-08-03 | 18 | Namecheap |
| savedm.com | save dm | 2008-08-22 | 2026-08-22 | 18 | Safenames Ltd. |
| dagranite65.com | da granite 65 | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| uhdmonitor.com | uhd monitor | 2008-08-04 | 2026-08-04 | 18 | Turncommerce, Inc. Dba Namebright.Com |
| virtual-exec.com | virtual exec | 2008-08-03 | 2026-08-03 | 18 | GoDaddy |
| rote-couch.com | rote couch | 2008-08-02 | 2026-08-02 | 18 | Ionos Se |
| ybhtm.com | ybhtm | 2008-08-05 | 2026-08-05 | 18 | NameSilo |
| vivrefute.com | vivre fute | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| thepremierproduce.com | the premier produce | 2009-08-03 | 2026-08-03 | 17 | Wild West Domains, Llc |
| fullforums.com | full forums | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| karenmillenvip.com | karen millen vip | 2009-08-05 | 2026-08-05 | 17 | Eurodns S.A. |
| evtini-samoletni-bileti-online.com | evtini samoletni bileti online | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| marketingturnarounds.com | marketing turnarounds | 2009-07-27 | 2026-08-04 | 17 | GoDaddy |
| notgettingpregnant.com | not getting pregnant | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| theitinerantgolfer.com | the itinerant golfer | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| jjhlt.com | jj hlt | 2009-08-15 | 2026-08-15 | 17 | Xin Net Technology Corporation |
| livredesminutes.com | livre des minutes | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| robertcranstoncpa.com | robert cranston cpa | 2009-11-04 | 2026-11-04 | 17 | GoDaddy |
| yourtrainingnow.com | your training now | 2009-11-04 | 2026-11-04 | 17 | GoDaddy |
| clutterandstuff.com | clutter and stuff | 2009-08-20 | 2026-08-20 | 17 | Ionos Se |
| careertelesummit.com | career tele summit | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| gloriasternlaw.com | gloria stern law | 2009-10-27 | 2026-08-03 | 17 | GoDaddy |
| bokfstore.com | bokf store | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| gummytoes.com | gummy toes | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| lifecoachlauraleonard.com | life coach laura leonard | 2009-08-04 | 2026-08-04 | 17 | Tucows Domains Inc. |
| blcarterconst.com | bl carter const | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| teamtriviami.com | team trivia mi | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| mattwalks.com | matt walks | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| cesar-tunisie.com | cesar tunisie | 2009-08-03 | 2026-08-03 | 17 | Wild West Domains, Llc |
| roofercam.com | roofer cam | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| sabonsabon.com | sabon sabon | 2009-08-02 | 2026-08-02 | 17 | Porkbun Llc |
| cassanovasjewelry.com | cassanovas jewelry | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| alchemybluffstudio.com | alchemy bluff studio | 2009-08-03 | 2026-08-03 | 17 | Dreamhost, Llc |
| wasi-shanghai.com | wasi shanghai | 2009-08-14 | 2026-08-14 | 17 | Gname.Com Pte. Ltd. |
| theindependentmusicawards.com | the independent music awards | 2009-08-04 | 2026-08-04 | 17 | NameSilo |
| schrader-associates.com | schrader associates | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| rocklandcountynyhomeinspector.com | rockland county ny home inspector | 2009-11-23 | 2026-08-03 | 17 | GoDaddy |
| all-inclusivesedans.com | all inclusive sedans | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| smoothenme.com | smoothen me | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| djdukes.com | dj dukes | 2009-08-01 | 2026-08-01 | 17 | Epik Llc |
| santafeartconsulting.com | santa fe art consulting | 2010-04-08 | 2027-04-08 | 17 | GoDaddy |
| dnksite.com | dnk site | 2009-08-03 | 2026-08-03 | 17 | 123-Reg Limited |
| saluth.com | saluth | 2009-08-04 | 2026-08-04 | 17 | Neubox Internet S.A. De C.V. |
| livresdesminutes.com | livres des minutes | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| electionmallcloud.com | election mall cloud | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| chinacrushers.com | china crushers | 2009-08-04 | 2026-08-04 | 17 | Dynadot |
| ministryxcellence.com | ministry xcellence | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| scottboltesanitation.com | scott bolte sanitation | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| daltonsdesigns.com | daltons designs | 2009-08-02 | 2026-08-02 | 17 | Namesecure L.L.C. |
| pierdut.com | pierdut | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| handraisedcreations.com | hand raised creations | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| sodiumsulfonate.com | sodium sulfonate | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| meetingwithsuccess.com | meeting with success | 2009-08-04 | 2026-08-04 | 17 | NameSilo |
| patriotepcr.com | patriot epcr | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| celsior-hills.com | celsior hills | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| happytaipei.com | happy taipei | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| wholesalekeylessremotes.com | wholesale keyless remotes | 2009-08-04 | 2026-08-04 | 17 | Wild West Domains, Llc |
| northtexasphotographyclub.com | north texas photography club | 2009-08-03 | 2026-08-03 | 17 | Enom, Llc |
| hao0537.com | hao 0537 | 2009-08-14 | 2026-08-14 | 17 | Gname.Com Pte. Ltd. |
| lipingqx.com | liping qx | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| echoellc.com | echoe llc | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| edsondantas.com | edson dantas | 2009-08-03 | 2026-08-03 | 17 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| burgerdivine.com | burger divine | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| buskullproperties.com | buskull properties | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| jeffersonlawpublishing.com | jefferson law publishing | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| imaptimize.com | imaptimize | 2009-08-03 | 2026-08-03 | 17 | Register.Com – Network Solutions, Llc |
| projectliftingspirits.com | project lifting spirits | 2009-08-05 | 2026-08-05 | 17 | Dynadot |
| waynelaganacompany.com | wayne lagana company | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| getridofaheadache.com | get rid of a headache | 2009-08-04 | 2026-08-04 | 17 | Turncommerce, Inc. Dba Namebright.Com |
| sybyd.com | sybyd | 2009-08-14 | 2026-08-14 | 17 | Gname.Com Pte. Ltd. |
| revivalretro.com | revival retro | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| shiltonassociates.com | shilton associates | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| primatechart.com | primate chart | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| tos50.com | tos 50 | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| sollscher.com | sollscher | 2009-09-14 | 2026-09-14 | 17 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| cable-tex.com | cable tex | 2009-08-03 | 2026-08-03 | 17 | Enom, Llc |
| nag-rd.com | nag rd | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| jiuhaodoors.com | jiuhao doors | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| citifood.com | citi food | 2009-08-06 | 2026-08-06 | 17 | Registrar Of Domain Names Reg.Ru Llc |
| icgays.com | ic gays | 2010-06-04 | 2027-06-04 | 17 | Internetx Gmbh |
| mysticcreekgolf.com | mystic creek golf | 2009-11-01 | 2026-11-01 | 17 | Dynadot |
| acousticianjobs.com | acoustician jobs | 2009-08-01 | 2026-08-01 | 17 | Mesh Digital Limited |
| egyfurp.com | egy furp | 2009-08-03 | 2026-08-03 | 17 | Spaceship, Inc. |
| domainassetmarkets.com | domain asset markets | 2009-08-02 | 2026-08-02 | 17 | Epik Llc |
| djmagftp.com | dj mag ftp | 2009-08-03 | 2026-08-03 | 17 | 123-Reg Limited |
| actsavings.com | act savings | 2009-08-04 | 2026-08-04 | 17 | Turncommerce, Inc. Dba Namebright.Com |
| mmocredits.com | mmo credits | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| campfiresmusic.com | campfires music | 2009-08-02 | 2026-08-02 | 17 | Dreamhost, Llc |
| carcaremadeeasy.com | car care made easy | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| axcks.com | axcks | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| smartlinktel.com | smart link tel | 2009-08-06 | 2026-08-06 | 17 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| koosdejongh.com | koos de jongh | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| etcxm.com | etcxm | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| yourinfoishere.com | your info is here | 2009-11-04 | 2026-11-04 | 17 | GoDaddy |
| unickcash4u.com | unick cash 4 u | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| integratedcomputingservices.com | integrated computing services | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| hanniballokumbe.com | hannibal lokumbe | 2009-08-02 | 2026-08-02 | 17 | Network Solutions, Llc |
| jannettejauregui.com | jannette jauregui | 2009-08-04 | 2026-08-04 | 17 | Tucows Domains Inc. |
| primerguys.com | primer guys | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| bicesterwools.com | bicester wools | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| fiscconseil.com | fisc conseil | 2009-08-02 | 2026-08-02 | 17 | Bluehost Inc. |
| sebastiansoler.com | sebastian soler | 2009-12-02 | 2026-12-02 | 17 | GoDaddy |
| aldcarauction.com | ald car auction | 2009-08-03 | 2026-08-03 | 17 | Realtime Register B.V. |
| srlnet-entertainment.com | srl net entertainment | 2009-08-02 | 2026-08-02 | 17 | Ionos Se |
| artsalestraining.com | art sales training | 2010-04-08 | 2027-04-08 | 17 | GoDaddy |
| jianshengtang.com | jian sheng tang | 2009-08-15 | 2026-08-15 | 17 | Xin Net Technology Corporation |
| xn--4gq71jqvbxy9i.com | xn--4gq71jqvbxy9i | 2009-08-03 | 2026-08-03 | 17 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| jenklein.com | jen klein | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| geiling-immobilien.com | geiling immobilien | 2009-11-19 | 2026-11-19 | 17 | Registrygate Gmbh |
| eyespycityguides.com | eye spy city guides | 2009-11-04 | 2026-11-04 | 17 | GoDaddy |
| mountainthunderracing.com | mountain thunder racing | 2009-04-22 | 2026-08-03 | 17 | GoDaddy |
| vmlse.com | vmlse | 2009-08-04 | 2026-08-04 | 17 | Tucows Domains Inc. |
| estudiobengoechea.com | estudio bengoechea | 2009-08-04 | 2026-08-04 | 17 | Wild West Domains, Llc |
| ukulelehk.com | ukulele hk | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| plagium-project.com | plagium project | 2010-01-27 | 2027-01-27 | 17 | GoDaddy |
| huangongtai.com | huan gong tai | 2009-08-14 | 2026-08-14 | 17 | Gname.Com Pte. Ltd. |
| premier-produce.com | premier produce | 2009-08-03 | 2026-08-03 | 17 | Wild West Domains, Llc |
| shengjiangpingtai.com | sheng jiang ping tai | 2009-08-15 | 2026-08-15 | 17 | Xin Net Technology Corporation |
| chucklegrowaviation.com | chuckle grow aviation | 2009-11-04 | 2026-11-04 | 17 | GoDaddy |
| karenmillenbespoke.com | karen millen bespoke | 2009-08-05 | 2026-08-05 | 17 | Eurodns S.A. |
| leeqoo.com | leeqoo | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| sosoheze.com | sosoheze | 2009-08-14 | 2026-08-14 | 17 | Gname.Com Pte. Ltd. |
| kfjinli.com | kf jinli | 2009-08-13 | 2026-08-13 | 17 | July Name Limited |
| imagemarkt.com | image markt | 2009-08-06 | 2026-08-06 | 17 | Registrar Of Domain Names Reg.Ru Llc |
| ceehotels.com | cee hotels | 2009-08-05 | 2026-08-05 | 17 | Gransy, S.R.O. |
| worldwide-enlightenment-intensives.com | worldwide enlightenment intensives | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| languageable.com | language able | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| homerentvacation.com | home rent vacation | 2009-08-02 | 2026-08-02 | 17 | Bluehost Inc. |
| fromagerie-bonal.com | fromagerie bonal | 2010-05-05 | 2027-05-05 | 17 | Orange |
| samairakumar.com | samaira kumar | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| mybloggercloud.com | my blogger cloud | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| theprimerguy.com | the primer guy | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| mammt.com | mammt | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| designmydiary.com | design my diary | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| bannerbusinessservices.com | banner business services | 2009-08-03 | 2026-08-03 | 17 | Enom, Llc |
| patriothelpdesk.com | patriot help desk | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| atkclothing.com | atk clothing | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| desksetchecks.com | desk set checks | 2009-08-05 | 2026-08-05 | 17 | NameSilo |
| oh2behealthy.com | oh 2 be healthy | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| tallaghtglazing.com | tallaght glazing | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| paragonfinanceltd.com | paragon finance ltd | 2009-08-03 | 2026-08-03 | 17 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| opcslimited.com | opcs limited | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| tobykeithsongs.com | toby keith songs | 2009-08-05 | 2026-08-05 | 17 | NameSilo |
| jnxmzk.com | jnxmzk | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| hopemobiles.com | hope mobiles | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| so888la.com | so 888 la | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| claimssupportinc.com | claims support inc | 2009-02-25 | 2026-08-03 | 17 | GoDaddy |
| drunkdrivingsentencinguidelines.com | drunkdrivingsentencinguidelines | 2009-08-03 | 2026-08-03 | 17 | Ionos Se |
| ctlled.com | ctl led | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| cmeartists.com | cme artists | 2009-08-04 | 2026-08-04 | 17 | NameSilo |
| gazillionofficeproducts.com | gazillion office products | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| crosseur.com | cross eur | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| sacbeewatch.com | sac bee watch | 2009-09-18 | 2026-09-18 | 17 | Csc Corporate Domains, Inc. |
| domainequitymarkets.com | domain equity markets | 2009-08-02 | 2026-08-02 | 17 | Epik Llc |
| o12o.com | o 12 o | 2009-08-02 | 2026-08-02 | 17 | Internet Domain Service Bs Corp |
| barweinig.com | bar weinig | 2009-09-15 | 2026-09-15 | 17 | Realtime Register B.V. |
| nagaratharpulligal.com | nagarathar pulligal | 2009-08-03 | 2026-08-03 | 17 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| gardenartistics.com | garden artistics | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| nonnenstudie.com | nonnen studie | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| imidipyrenees.com | imidipyrenees | 2009-09-15 | 2026-09-15 | 17 | Nameshield Sas |
| sohakhan.com | soha khan | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| dreamingmirrormedia.com | dreaming mirror media | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| mydonorcloud.com | my donor cloud | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| premierproduceonline.com | premier produce online | 2009-08-03 | 2026-08-03 | 17 | Wild West Domains, Llc |
| shineonadime.com | shine on a dime | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| differentpov.com | different pov | 2009-08-02 | 2026-08-02 | 17 | Bluehost Inc. |
| lzfksp.com | lzfksp | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| valley-view-memorial-park.com | valley view memorial park | 2009-08-04 | 2026-08-04 | 17 | Tucows Domains Inc. |
| claretrecruitment.com | claret recruitment | 2009-08-03 | 2026-08-03 | 17 | 123-Reg Limited |
| smileswithinmiles.com | smiles within miles | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| carolinamountaindog.com | carolina mountain dog | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| looksformen.com | looks for men | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| cellulitetreatmentcream.com | cellulite treatment cream | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| concentrateddetergent.com | concentrated detergent | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| medicalltd.com | medical ltd | 2009-08-04 | 2026-08-04 | 17 | Turncommerce, Inc. Dba Namebright.Com |
| dgmxzy.com | dgmxzy | 2009-08-14 | 2026-08-14 | 17 | Gname.Com Pte. Ltd. |
| sototallyawesome.com | so totally awesome | 2009-08-03 | 2026-08-03 | 17 | Wild West Domains, Llc |
| bayareasexaddict.com | bay area sex addict | 2009-08-04 | 2026-08-04 | 17 | Tucows Domains Inc. |
| ltzgsh.com | ltzgsh | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| politforumi.com | polit forumi | 2009-08-02 | 2026-08-02 | 17 | Domain.Com – Network Solutions, Llc |
| sexydesistories.com | sexy desi stories | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| shecanic.com | she canic | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| thesoundandlightcompany.com | the sound and light company | 2009-08-02 | 2026-08-02 | 17 | Enom, Llc |
| ruckus-wireless.com | ruckus wireless | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| videosfortrainers.com | videos for trainers | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| art-mst.com | art mst | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| nwhealthcaresolutions.com | nw healthcare solutions | 2010-03-12 | 2027-03-12 | 17 | GoDaddy |
| cbcustombuilders.com | cb custom builders | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| map-app.com | map app | 2009-11-06 | 2026-11-06 | 17 | Vautron Rechenzentrum Ag |
| mdjxywy.com | mdjxywy | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| weirdimagination.com | weird imagination | 2009-08-02 | 2026-08-02 | 17 | Bluehost Inc. |
| jinhuabowen.com | jin hua bowen | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| louiswalence.com | louis walence | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| yurt-rehberi.com | yurt rehberi | 2009-08-03 | 2026-08-03 | 17 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| studiobidart.com | studio bidart | 2009-08-04 | 2026-08-04 | 17 | Wild West Domains, Llc |
| bizdommagazine.com | biz dom magazine | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| iaveyron.com | i aveyron | 2009-09-15 | 2026-09-15 | 17 | Nameshield Sas |
| fx3festival.com | fx 3 festival | 2009-08-04 | 2026-08-04 | 17 | Easyspace Limited |
| hamadema.com | hamadema | 2009-08-02 | 2026-08-02 | 17 | Bluehost Inc. |
| arscopy.com | ars copy | 2009-09-18 | 2026-09-18 | 17 | Csc Corporate Domains, Inc. |
| carriecainsparks.com | carrie cain sparks | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| primerguy.com | primer guy | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| chihuawow.com | chihua wow | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| romeweddingsphotography.com | rome weddings photography | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| powersmail.com | powers mail | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| siamsquareprint.com | siam square print | 2009-08-05 | 2026-08-05 | 17 | Web Commerce Communications Limited Dba Webnic.Cc |
| altenative-bank.com | altenative bank | 2009-10-15 | 2026-10-15 | 17 | Mesh Digital Limited |
| sun-traxx.com | sun traxx | 2009-08-02 | 2026-08-02 | 17 | Ionos Se |
| bostonmerlin.com | boston merlin | 2009-08-14 | 2026-08-14 | 17 | Netearth One Inc. D/B/A Netearth |
| cheshiretopsoil.com | cheshire topsoil | 2009-08-03 | 2026-08-03 | 17 | 123-Reg Limited |
| jeffbourassa.com | jeff bourassa | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| lfncopiadoras.com | lfn copiadoras | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| myvolunteercloud.com | my volunteer cloud | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| justforbuffalo.com | just for buffalo | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| royaarab.com | roya arab | 2009-08-03 | 2026-08-03 | 17 | 123-Reg Limited |
| correctingk9s.com | correcting k9s | 2009-08-03 | 2026-08-03 | 17 | Dreamhost, Llc |
| jrteeter.com | jr teeter | 2009-11-04 | 2026-11-04 | 17 | GoDaddy |
| nanobotinjections.com | nano bot injections | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| aquaticagrupo.com | aquatica grupo | 2009-08-03 | 2026-08-03 | 17 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| culturemutt.com | culture mutt | 2009-08-02 | 2026-08-02 | 17 | Ionos Se |
| coudouret-splm.com | coudouret splm | 2009-12-09 | 2026-12-09 | 17 | Orange |
| war-geek.com | war geek | 2009-08-03 | 2026-08-03 | 17 | Ionos Se |
| valetpremiuminc.com | valet premium inc | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| profarc.com | prof arc | 2009-08-03 | 2026-08-03 | 17 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| chun5.com | chun 5 | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| joinbpogroup.com | join bpo group | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| nexos-online.com | nexos online | 2009-10-08 | 2026-10-08 | 17 | Orange |
| jessicatannerphotography.com | jessica tanner photography | 2009-08-03 | 2026-08-03 | 17 | Wild West Domains, Llc |
| sconline-llc.com | sc online llc | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| motoley.com | motoley | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| radiasunmeters.com | radia sun meters | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| wolverang.com | wolverang | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| legrowaviation.com | le grow aviation | 2009-11-04 | 2026-11-04 | 17 | GoDaddy |
| basilalkazzi-foundation-rca.com | basil alkazzi foundation rca | 2009-08-02 | 2026-08-02 | 17 | Enom, Llc |
| weilusujian.com | wei lu su jian | 2009-08-12 | 2026-08-12 | 17 | Bizcn.Com, Inc. |
| schenkerturkey.com | schenker turkey | 2009-08-05 | 2026-08-05 | 17 | Eurodns S.A. |
| strategicadvantagemedia.com | strategic advantage media | 2009-08-04 | 2026-08-04 | 17 | Tucows Domains Inc. |
| ystavat.com | ystavat | 2009-08-05 | 2026-08-05 | 17 | Dynadot |
| hoffmannresearch.com | hoffmann research | 2009-09-09 | 2026-09-09 | 17 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| csabitasakademia.com | csabitas akademia | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| digitalquickstart.com | digital quick start | 2009-08-03 | 2026-08-03 | 17 | Spaceship, Inc. |
| szbaobo.com | sz baobo | 2009-08-12 | 2026-08-12 | 17 | Jiangsu Bangning Science & Technology Co. Ltd. |
| smoglives.com | smog lives | 2009-08-05 | 2026-08-05 | 17 | NameSilo |
| jinjibao.com | jin ji bao | 2009-08-06 | 2026-08-06 | 17 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| aletracaixa.com | aletra caixa | 2009-08-04 | 2026-08-04 | 17 | Marcaria International Llc |
| agraria-expo.com | agraria expo | 2010-05-12 | 2027-05-12 | 17 | Key-Systems Gmbh |
| clinicasaluth.com | clinica saluth | 2009-08-04 | 2026-08-04 | 17 | Neubox Internet S.A. De C.V. |
| nbaodejx.com | nba ode jx | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| digitalvanlines.com | digital van lines | 2009-11-13 | 2026-11-13 | 17 | GoDaddy |
| njworkerscompattorneys.com | nj workers comp attorneys | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| executivestrategicresources.com | executive strategic resources | 2009-08-02 | 2026-08-02 | 17 | Domain.Com – Network Solutions, Llc |
| ppids.com | ppids | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| twtourguide.com | tw tour guide | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| judygraf.com | judy graf | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| howtobabysteps.com | how to baby steps | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| kkseedstock.com | kk seed stock | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| barterpreneurs.com | barter preneurs | 2009-08-04 | 2026-08-04 | 17 | Turncommerce, Inc. Dba Namebright.Com |
| poshnchicprints.com | posh n chic prints | 2009-08-03 | 2026-08-03 | 17 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| chapeau-klapp.com | chapeau klapp | 2010-08-16 | 2027-08-16 | 17 | Mesh Digital Limited |
| mfsag.com | mfsag | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| hhdomains.com | hh domains | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| nickorebelmusic.com | nicko rebel music | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| 2travelingthompsons.com | 2 traveling thompsons | 2009-08-02 | 2026-08-02 | 17 | Ionos Se |
| i-subpoena.com | i subpoena | 2009-09-18 | 2026-09-18 | 17 | Csc Corporate Domains, Inc. |
| torchbearerstudios.com | torchbearer studios | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| vinapack.com | vina pack | 2009-08-10 | 2026-08-10 | 17 | P.A. Viet Nam Company Limited |
| davidturecamo.com | david turecamo | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| tuneinunlockattain.com | tune in unlock attain | 2009-08-05 | 2026-08-05 | 17 | Dynadot |
| cassandrarealtor.com | cassandra realtor | 2009-08-03 | 2026-08-03 | 17 | Wild West Domains, Llc |
| hotelinzell.com | hotel inzell | 2009-08-04 | 2026-08-04 | 17 | Turncommerce, Inc. Dba Namebright.Com |
| moltiplast.com | molti plast | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| amitubes.com | ami tubes | 2010-03-12 | 2027-03-12 | 17 | Orange |
| gdyuyang.com | gd yu yang | 2009-08-12 | 2026-08-12 | 17 | Bizcn.Com, Inc. |
| read-article.com | read article | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| tuncmetalkumlama.com | tunc metal kumlama | 2009-08-05 | 2026-08-05 | 17 | Onlinenic, Inc. |
| nizguy.com | niz guy | 2009-08-04 | 2026-08-04 | 17 | Turncommerce, Inc. Dba Namebright.Com |
| westfallenterprises.com | westfall enterprises | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| zacomega.com | zac omega | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| baishafly.com | bai sha fly | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| xiongbaby.com | xiong baby | 2009-08-14 | 2026-08-14 | 17 | Gname.Com Pte. Ltd. |
| parrackfinancial.com | parrack financial | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| egyptianshow.com | egyptian show | 2009-08-04 | 2026-08-04 | 17 | Turncommerce, Inc. Dba Namebright.Com |
| develtronics.com | devel tronics | 2010-08-16 | 2027-08-16 | 17 | Mesh Digital Limited |
| plagiumproject.com | plagium project | 2010-01-27 | 2027-01-27 | 17 | GoDaddy |
| theprimerguys.com | the primer guys | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| some-sas.com | some sas | 2010-01-21 | 2027-01-21 | 17 | Orange |
| pimmit-run.com | pimmit run | 2009-08-03 | 2026-08-03 | 17 | Ionos Se |
| shanti-ctm.com | shanti ctm | 2009-08-04 | 2026-08-04 | 17 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| jezzoriginals.com | jezz originals | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| juniorinternational.com | junior international | 2009-08-02 | 2026-08-02 | 17 | Annulet Llc |
| sztdf.com | sz tdf | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| mypremierproduce.com | my premier produce | 2009-08-03 | 2026-08-03 | 17 | Wild West Domains, Llc |
| halldiary.com | hall diary | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| paintfactoryorlando.com | paint factory orlando | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| hezuozhe.com | he zuo zhe | 2009-08-03 | 2026-08-03 | 17 | Spaceship, Inc. |
| ambientmedia-group.com | ambient media group | 2009-08-01 | 2026-08-01 | 17 | United-Domains Gmbh |
| medlegalcopy.com | med legal copy | 2009-09-18 | 2026-09-18 | 17 | Csc Corporate Domains, Inc. |
| naturadical.com | naturadical | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| jdchaser.com | jd chaser | 2009-11-04 | 2026-11-04 | 17 | GoDaddy |
| ckraresearch.com | ckr a research | 2009-08-10 | 2026-08-03 | 17 | GoDaddy |
| yysclw.com | yy sclw | 2009-08-14 | 2026-08-14 | 17 | Gname.Com Pte. Ltd. |
| sugiatoc.com | sugiato c | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| ocbuiltinvac.com | oc built in vac | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| dvabrasil.com | dva brasil | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| mycampaigncloud.com | my campaign cloud | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| qydns6.com | qy dns 6 | 2009-08-06 | 2026-08-06 | 17 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| coolgreensolar.com | cool green solar | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| liberalesmexicanos.com | liberales mexicanos | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| dereklaporte.com | derek laporte | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| southalabamaspayneuter.com | south alabama spay neuter | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| hikvisiondvrs.com | hikvision dvrs | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| sagenaturalresources.com | sage natural resources | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| goodenergyguy.com | good energy guy | 2009-08-03 | 2026-08-03 | 17 | Bluehost Inc. |
| imidi-pyrenees.com | imidi pyrenees | 2009-09-15 | 2026-09-15 | 17 | Nameshield Sas |
| justiceformankind.com | justice for mankind | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| sumburghairport.com | sumburgh airport | 2009-08-03 | 2026-08-03 | 17 | 123-Reg Limited |
| sealedheat.com | sealed heat | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| urbssacra.com | urbs sacra | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| npforme.com | np for me | 2009-08-03 | 2026-08-03 | 17 | Network Solutions, Llc |
| jeffreywphillips.com | jeffrey w phillips | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| digitalpackageservice.com | digital package service | 2009-11-21 | 2026-11-21 | 17 | GoDaddy |
| olddjmag.com | old dj mag | 2009-08-03 | 2026-08-03 | 17 | 123-Reg Limited |
| martinebyoga.com | martine b yoga | 2009-08-03 | 2026-08-03 | 17 | 123-Reg Limited |
| afrocut.com | afro cut | 2009-08-01 | 2026-08-01 | 17 | Sav.Com, Llc |
| qs-tiles.com | qs tiles | 2009-08-03 | 2026-08-03 | 17 | Enom, Llc |
| algae2o.com | algae 2 o | 2010-08-02 | 2027-08-02 | 17 | Network Solutions, Llc |
| justhumanarchitecture.com | just human architecture | 2009-09-15 | 2026-09-15 | 17 | Registrygate Gmbh |
| americaspackleader.com | americas pack leader | 2009-08-04 | 2026-08-04 | 17 | GoDaddy |
| qzhjfy.com | qz hjfy | 2009-08-14 | 2026-08-14 | 17 | Gname.Com Pte. Ltd. |
| 7-24consultores.com | 7 24 consultores | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| amarioil.com | amari oil | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| perfectphotoart.com | perfect photo art | 2009-11-05 | 2026-11-05 | 17 | GoDaddy |
| ambenseni.com | ambenseni | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| somethinginus.com | something in us | 2009-08-02 | 2026-08-02 | 17 | Ionos Se |
| altenativbank.com | altenativ bank | 2009-10-15 | 2026-10-15 | 17 | Mesh Digital Limited |
| nurturingparentsandteachers.com | nurturing parents and teachers | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| autodepotnc.com | auto depot nc | 2009-08-04 | 2026-08-04 | 17 | NameSilo |
| victoriastationlondon.com | victoria station london | 2009-10-15 | 2026-08-03 | 17 | GoDaddy |
| mynewmediacloud.com | my new media cloud | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| chinacityscapes.com | china cityscapes | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| xn--9d0by7j2qm0ma583d23h.com | xn--9d0by7j2qm0ma583d23h | 2009-08-04 | 2026-08-04 | 17 | Megazone Corp., Dba Hosting.Kr |
| growherbsinfo.com | grow herbs info | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| duotaihecheng.com | duo tai he cheng | 2009-08-09 | 2026-08-09 | 17 | Todaynic.Com, Inc. |
| tuantijp.com | tuan ti jp | 2009-08-14 | 2026-08-14 | 17 | Gname.Com Pte. Ltd. |
| yewsoon.com | yew soon | 2009-08-05 | 2026-08-05 | 17 | Shanghai Best Oray Information S&T Co., Ltd. |
| waltonandbeckereyecare.com | walton and becker eyecare | 2009-08-03 | 2026-08-03 | 17 | Namecheap |
| defrostwatch.com | defrost watch | 2009-08-03 | 2026-08-03 | 17 | 123-Reg Limited |
| start2start.com | start 2 start | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| customerprizes.com | customer prizes | 2009-08-03 | 2026-08-03 | 17 | GoDaddy |
| jxygltzx.com | jx ygltzx | 2009-08-13 | 2026-08-13 | 17 | Gname.Com Pte. Ltd. |
| digitalmovingandstorage.com | digital moving and storage | 2009-11-13 | 2026-11-13 | 17 | GoDaddy |
| tanfilx.com | tanfilx | 2009-08-02 | 2026-08-02 | 17 | Network Solutions, Llc |
| podsiekierkami.com | pod siekierkami | 2009-08-04 | 2026-08-04 | 17 | Netart Registrar Sp. Z O.O. |
| drugrehabcypress.com | drug rehab cypress | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbaywoodlososos.com | drug rehab baywood los osos | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| serveprotwinports.com | serve pro twin ports | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhermiston.com | drug rehab hermiston | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| jerryiannucci.com | jerry iannucci | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabione.com | drug rehab ione | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| pixel-pyro.com | pixel pyro | 2010-08-12 | 2026-08-12 | 16 | Register Spa |
| georgewombwell.com | george wombwell | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablakearrowhead.com | drug rehab lake arrowhead | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabnorthbend.com | drug rehab north bend | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcupertino.com | drug rehab cupertino | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| resumebuildingworksheet.com | resume building worksheet | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcitrus.com | drug rehab citrus | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| comprapormexico.com | compra por mexico | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabenumclaw.com | drug rehab enumclaw | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdinuba.com | drug rehab dinuba | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabroseland.com | drug rehab roseland | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| tupthonggroup.com | tup thong group | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| outstandingpresentationsworkshop.com | outstanding presentations workshop | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabyucaipa.com | drug rehab yucaipa | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| upliftingwealth.com | uplifting wealth | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabranchosantamargarita.com | drug rehab rancho santa margarita | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| natamakart.com | natama kart | 2010-08-12 | 2026-08-12 | 16 | Regional Network Information Center, Jsc Dba Ru-Center |
| lilac-design.com | lilac design | 2010-08-03 | 2026-08-03 | 16 | 123-Reg Limited |
| activeandlovingit.com | active and loving it | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabmohavevalley.com | drug rehab mohave valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdanapoint.com | drug rehab dana point | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablomita.com | drug rehab lomita | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabferndale.com | drug rehab ferndale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| cloverlandmotorsmi.com | cloverland motors mi | 2010-08-03 | 2026-08-03 | 16 | Wild West Domains, Llc |
| drugrehabsweethome.com | drug rehab sweet home | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| eftechnics.com | ef technics | 2010-08-02 | 2026-08-02 | 16 | Key-Systems Gmbh |
| drugrehabstanford.com | drug rehab stanford | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| videoklash.com | video klash | 2010-04-12 | 2026-08-02 | 16 | Porkbun Llc |
| esalesmentor.com | e sales mentor | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabwashingtonterrace.com | drug rehab washington terrace | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabelmirage.com | drug rehab el mirage | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsouthlaketahoe.com | drug rehab south lake tahoe | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| xinpugroup.com | xin pu group | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabtroutdale.com | drug rehab troutdale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsusanville.com | drug rehab susanville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfortlupton.com | drug rehab fort lupton | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| jktruckparts.com | jk truck parts | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| junksniffer.com | junk sniffer | 2010-08-04 | 2026-08-04 | 16 | Wild West Domains, Llc |
| verticalwineconsulting.com | vertical wine consulting | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabelsegundo.com | drug rehab el segundo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtulare.com | drug rehab tulare | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablennox.com | drug rehab lennox | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| energysavings2020.com | energy savings 2020 | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| arrowheadpoloclub.com | arrowhead polo club | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| bedtimeexperiments.com | bedtime experiments | 2010-08-03 | 2026-08-03 | 16 | Ionos Se |
| ww-ea.com | ww ea | 2010-08-02 | 2026-08-02 | 16 | Ionos Se |
| stjohngaming.com | st john gaming | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtaft.com | drug rehab taft | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| thejoxnation.com | the jox nation | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| boardofknowledgesigns.com | board of knowledge signs | 2010-08-03 | 2026-08-03 | 16 | Bluehost Inc. |
| drugrehabfortcarson.com | drug rehab fort carson | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcampbell.com | drug rehab campbell | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| plazaloanflyers.com | plaza loan flyers | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeastpasadena.com | drug rehab east pasadena | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabrivertonboulevardpark.com | drug rehab riverton boulevard park | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabarcadia.com | drug rehab arcadia | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| 1afx.com | 1 afx | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabnorthauburn.com | drug rehab north auburn | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwillowbrook.com | drug rehab willowbrook | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcastroville.com | drug rehab castroville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| kletterhalle-nuernberg.com | kletterhalle nuernberg | 2010-10-08 | 2026-10-08 | 16 | Registrygate Gmbh |
| arkansasattorneydirectory.com | arkansas attorney directory | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| atyint.com | aty int | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| erectiledysfunctionlawyer.com | erectile dysfunction lawyer | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| rejuvinatingvagina.com | rejuvinating vagina | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabglendora.com | drug rehab glendora | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcatalina.com | drug rehab catalina | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabnorthmarysville.com | drug rehab north marysville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| huddlestonengineering.com | huddleston engineering | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsilverdale.com | drug rehab silverdale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsancarlos.com | drug rehab san carlos | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| dragonenterprisesolutions.com | dragon enterprise solutions | 2010-08-02 | 2026-08-02 | 16 | Hostopia Canada Corp |
| fa-position.com | fa position | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| soheililaw.com | soheili law | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabsouthoroville.com | drug rehab south oroville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanluisobispo.com | drug rehab san luis obispo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsonora.com | drug rehab sonora | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabclaremont.com | drug rehab claremont | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmenlopark.com | drug rehab menlo park | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| waplb.com | waplb | 2010-08-06 | 2026-08-06 | 16 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| thelittleblueroom.com | the little blue room | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehablynden.com | drug rehab lynden | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeastrentonhighlands.com | drug rehab east renton highlands | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| optionsurgentcare.com | options urgent care | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabavenal.com | drug rehab avenal | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmagalia.com | drug rehab magalia | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbostonia.com | drug rehab bostonia | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| agrodvor.com | agro dvor | 2010-08-06 | 2026-08-06 | 16 | Registrar Of Domain Names Reg.Ru Llc |
| drugrehabatherton.com | drug rehab atherton | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| buygiftcards-online.com | buy gift cards online | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcenterville.com | drug rehab centerville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabblackforest.com | drug rehab black forest | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| only4docs.com | only 4 docs | 2010-08-01 | 2026-08-01 | 16 | Ionos Se |
| ihpwellness.com | ihp wellness | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwintergardens.com | drug rehab winter gardens | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| lvabill.com | lva bill | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabpayson.com | drug rehab payson | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcotati.com | drug rehab cotati | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtustinfoothills.com | drug rehab tustin foothills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabarvin.com | drug rehab arvin | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| ronmulder.com | ron mulder | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablemongrove.com | drug rehab lemon grove | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhayesville.com | drug rehab hayesville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabprairieridge.com | drug rehab prairie ridge | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsteilacoom.com | drug rehab steilacoom | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsterling.com | drug rehab sterling | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcorcoran.com | drug rehab corcoran | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabalamo.com | drug rehab alamo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabnorthhighlands.com | drug rehab north highlands | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| 021-xuanyi.com | 021 xuanyi | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| prodevnet.com | pro dev net | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabstratmoor.com | drug rehab stratmoor | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| lithiumforbipolar.com | lithium for bipolar | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| solermovies.com | soler movies | 2010-08-01 | 2026-08-01 | 16 | Key-Systems Gmbh |
| drugrehabmurrieta.com | drug rehab murrieta | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabrosemont.com | drug rehab rosemont | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmillbrae.com | drug rehab millbrae | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwilsonville.com | drug rehab wilsonville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsantee.com | drug rehab santee | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcarmichael.com | drug rehab carmichael | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabephrata.com | drug rehab ephrata | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtemplecity.com | drug rehab temple city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcorning.com | drug rehab corning | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| 3rdrockart.com | 3rd rock art | 2010-08-02 | 2026-08-02 | 16 | Network Solutions, Llc |
| servicepromo.com | service promo | 2010-08-02 | 2026-08-02 | 16 | Network Solutions, Llc |
| drugrehabcanoncity.com | drug rehab canon city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabseaside.com | drug rehab seaside | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabkentfield.com | drug rehab kentfield | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbrea.com | drug rehab brea | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| hokupt.com | hok upt | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabparkwaysouthsacramento.com | drug rehab parkway south sacramento | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| sdsaishang.com | sd saishang | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| djslowmo.com | dj slowmo | 2010-08-04 | 2026-08-04 | 16 | Wild West Domains, Llc |
| 000709.com | 000709 | 2010-08-06 | 2026-08-06 | 16 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| drugrehablinda.com | drug rehab linda | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| sofiadesandro.com | sofia desandro | 2010-08-03 | 2026-08-03 | 16 | Wild West Domains, Llc |
| drugrehabcapitola.com | drug rehab capitola | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| kuwaitaffairs.com | kuwait affairs | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhillsborough.com | drug rehab hillsborough | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhermosabeach.com | drug rehab hermosa beach | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| rodliberal.com | rod liberal | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsouthpasadena.com | drug rehab south pasadena | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabparadisevalley.com | drug rehab paradise valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabflorin.com | drug rehab florin | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| motoring-solicitors.com | motoring solicitors | 2010-08-03 | 2026-08-03 | 16 | 123-Reg Limited |
| drugrehaboakhills.com | drug rehab oak hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbuckeye.com | drug rehab buckeye | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| quicbill.com | quic bill | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| thedailytrade.com | the daily trade | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabemeryville.com | drug rehab emeryville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| peteuthanasiahome.com | pet euthanasia home | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| farmaciademanipulacaopoa.com | farmacia de manipulacao poa | 2010-08-04 | 2026-08-04 | 16 | Tucows Domains Inc. |
| rochestermaterialshandling.com | rochester materials handling | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgardenacres.com | drug rehab garden acres | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| patiodelray.com | patio del ray | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsonoma.com | drug rehab sonoma | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmarinadelrey.com | drug rehab marina del rey | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| voiceofcarthage.com | voice of carthage | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| lithuanianinterpreter.com | lithuanian interpreter | 2010-08-12 | 2026-08-12 | 16 | Register Spa |
| duaneahl.com | duane ahl | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabkingsburg.com | drug rehab kingsburg | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsilverton.com | drug rehab silverton | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| openlygaymarketing.com | openly gay marketing | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehablapresa.com | drug rehab la presa | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdelaire.com | drug rehab del aire | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfortlewis.com | drug rehab fort lewis | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablemoore.com | drug rehab lemoore | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablemmonvalleygoldenvalley.com | drug rehab lemmon valley golden valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| servproofthetwinports.com | servpro of the twin ports | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablincolncity.com | drug rehab lincoln city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmountolympus.com | drug rehab mount olympus | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| szchina100.com | sz china 100 | 2010-08-14 | 2026-08-14 | 16 | Gname.Com Pte. Ltd. |
| foodtrucktracks.com | food truck tracks | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| mistubishicomfort.com | mistubishi comfort | 2010-08-02 | 2026-08-02 | 16 | Key-Systems Gmbh |
| drugrehablamirada.com | drug rehab la mirada | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| archiecropley.com | archie cropley | 2010-08-03 | 2026-08-03 | 16 | Dreamhost, Llc |
| sidyocool.com | sidyo cool | 2010-08-04 | 2026-08-04 | 16 | Tucows Domains Inc. |
| czjinher.com | cz jinher | 2010-08-04 | 2026-08-04 | 16 | Dynadot |
| drugrehabnorthogden.com | drug rehab north ogden | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdelmar.com | drug rehab del mar | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabrollinghillsestates.com | drug rehab rolling hills estates | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| jlxdny.com | jlxdny | 2010-08-14 | 2026-08-14 | 16 | Gname.Com Pte. Ltd. |
| drugrehabalumrock.com | drug rehab alum rock | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanjuancapistrano.com | drug rehab san juan capistrano | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| manamadating.com | manama dating | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| lithiumeffects.com | lithium effects | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmontecito.com | drug rehab montecito | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablamesa.com | drug rehab la mesa | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgreen.com | drug rehab green | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| livingwhealthy.com | living w healthy | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabpinole.com | drug rehab pinole | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabflorencegraham.com | drug rehab florence graham | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabjenningslodge.com | drug rehab jennings lodge | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| baymeadowsnewhomes.com | bay meadows new homes | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcoolidge.com | drug rehab coolidge | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdelano.com | drug rehab delano | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| davetriesballet.com | dave tries ballet | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabscottsvalley.com | drug rehab scotts valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabprice.com | drug rehab price | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| vagalicious.com | vagalicious | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsherrelwood.com | drug rehab sherrelwood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsierramadre.com | drug rehab sierra madre | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| rrfmusic.com | rrf music | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| airyim.com | airy im | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsandimas.com | drug rehab san dimas | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| knighttimecomedy.com | knight time comedy | 2010-08-02 | 2026-08-02 | 16 | Domain.Com – Network Solutions, Llc |
| christmas-gift-card.com | christmas gift card | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcalexico.com | drug rehab calexico | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwoodlandpark.com | drug rehab woodland park | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| traveldatasystem.com | travel data system | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabduarte.com | drug rehab duarte | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| seconderotic.com | second erotic | 2010-08-21 | 2026-08-21 | 16 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| drugrehabavocadoheights.com | drug rehab avocado heights | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| michiganfarflyers.com | michigan far flyers | 2010-08-02 | 2026-08-02 | 16 | Enom, Llc |
| cornerofficecoach.com | corner office coach | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| davidchidester.com | david chidester | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcortez.com | drug rehab cortez | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| lucentvip.com | lucent vip | 2010-08-03 | 2026-08-03 | 16 | Ionos Se |
| drugrehabladeraheights.com | drug rehab ladera heights | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| cosmeticdentistinbrick.com | cosmetic dentist in brick | 2010-08-03 | 2026-08-03 | 16 | Wild West Domains, Llc |
| drugrehabelpasoderobles.com | drug rehab el paso de robles | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabveradale.com | drug rehab veradale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| manologyvancouver.com | manology vancouver | 2011-06-10 | 2027-06-10 | 16 | Wild West Domains, Llc |
| drugrehabrubidoux.com | drug rehab rubidoux | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| topdesignerswi.com | top designers wi | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfivecorners.com | drug rehab five corners | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehaboakharbor.com | drug rehab oak harbor | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| stividor.com | stividor | 2010-08-10 | 2026-08-10 | 16 | Regional Network Information Center, Jsc Dba Ru-Center |
| drugrehableahill.com | drug rehab lea hill | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabclarkston.com | drug rehab clarkston | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| winkburcham.com | wink burcham | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| cjohnsonlandscapeco.com | c johnson landscape co | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsierravistasoutheast.com | drug rehab sierra vista southeast | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| trooloo.com | trooloo | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehaboquirrh.com | drug rehab oquirrh | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| virginiabeachmassages.com | virginia beach massages | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| euroshred.com | euro shred | 2010-08-02 | 2026-08-02 | 16 | Ionos Se |
| drugrehabalderwoodmanor.com | drug rehab alderwood manor | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgraham.com | drug rehab graham | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabnationalcity.com | drug rehab national city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabpedley.com | drug rehab pedley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmarana.com | drug rehab marana | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| theinvestorsstrategist.com | the investors strategist | 2010-08-02 | 2026-08-02 | 16 | Network Solutions, Llc |
| drugrehabsanger.com | drug rehab sanger | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| longmontcoloradohomesearch.com | longmont colorado home search | 2010-07-27 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfairwood.com | drug rehab fairwood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfountain.com | drug rehab fountain | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| plazaloansflyers.com | plaza loans flyers | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmaywood.com | drug rehab maywood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| dohadating.com | doha dating | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| ishalaan.com | ishalaan | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabhollister.com | drug rehab hollister | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmckinleyville.com | drug rehab mckinleyville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfreedomca.com | drug rehab freedom ca | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| wholesaletileonline.com | wholesale tile online | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabperris.com | drug rehab perris | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| internetdatingscience.com | internet dating science | 2010-08-04 | 2026-08-04 | 16 | NameSilo |
| drugrehablakemortonberrydale.com | drug rehab lake morton berrydale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| trackfoodtrucks.com | track food trucks | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabcimarronhills.com | drug rehab cimarron hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcambria.com | drug rehab cambria | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabrosamond.com | drug rehab rosamond | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmiltonfreewater.com | drug rehab milton freewater | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeastporterville.com | drug rehab east porterville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbakercity.com | drug rehab baker city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdeweyhumboldt.com | drug rehab dewey humboldt | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| wallmountworldonline.com | wall mount world online | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| ironweft.com | iron weft | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| wine-making-blog.com | wine making blog | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabcharteroak.com | drug rehab charter oak | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabstonegate.com | drug rehab stonegate | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| futurecho.com | futurecho | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabportolahills.com | drug rehab portola hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhealdsburg.com | drug rehab healdsburg | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbonita.com | drug rehab bonita | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsedrowoolley.com | drug rehab sedro woolley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabyubacity.com | drug rehab yuba city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbelmont.com | drug rehab belmont | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| 41gallery.com | 41 gallery | 2010-08-06 | 2026-08-06 | 16 | Pair Networks, Inc. D/B/A Pair Domains |
| drugrehabgigharbor.com | drug rehab gig harbor | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanmateo.com | drug rehab san mateo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcarmelvalleyvillage.com | drug rehab carmel valley village | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| lesliesrqproductions.com | leslie srq productions | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| cvlincusa.com | cvl inc usa | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| bjhaoxiangni.com | bj hao xiang ni | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabwesthavensylvan.com | drug rehab west haven sylvan | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabflowingwells.com | drug rehab flowing wells | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtucsonestates.com | drug rehab tucson estates | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablamont.com | drug rehab lamont | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| xn--czrr7bjo895j.com | xn--czrr7bjo895j | 2010-08-05 | 2026-08-05 | 16 | Dynadot |
| famhove.com | fam hove | 2010-08-04 | 2026-08-04 | 16 | Domeneshop As Dba Domainnameshop.Com |
| ahjmsl.com | ahjmsl | 2010-08-14 | 2026-08-14 | 16 | Gname.Com Pte. Ltd. |
| resumebuildingworkshop.com | resume building workshop | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabinclinevillagecrystalbay.com | drug rehab incline village crystal bay | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabelcerrito.com | drug rehab el cerrito | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| homeinaleppo.com | home in aleppo | 2010-08-02 | 2026-08-02 | 16 | Ionos Se |
| drugrehabmaplevalley.com | drug rehab maple valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| serious-parody.com | serious parody | 2010-08-02 | 2026-08-02 | 16 | Ionos Se |
| longmonthomesearch.com | longmont home search | 2010-07-27 | 2026-08-03 | 16 | GoDaddy |
| havenportfurniture.com | haven port furniture | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| sinterklaasonline.com | sinterklaas online | 2010-09-15 | 2026-09-15 | 16 | Metaregistrar Bv |
| drugrehabsignalhill.com | drug rehab signal hill | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| kindnesssmallanimalvet.com | kindness small animal vet | 2010-08-01 | 2026-08-01 | 16 | Domain Science Kutatási Szolgáltató Korlátolt Felelősségű Társaság |
| echipamentpescuit.com | echipament pescuit | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgonzales.com | drug rehab gonzales | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablapuente.com | drug rehab la puente | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| milkandhoneyinteriordesign.com | milk and honey interior design | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtwentyninepalmsbase.com | drug rehab twenty nine palms base | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabminnehaha.com | drug rehab minnehaha | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabstanton.com | drug rehab stanton | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanfernando.com | drug rehab san fernando | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| dogtrainingrewards.com | dog training rewards | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabramona.com | drug rehab ramona | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| poontangpower.com | poontang power | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabazusa.com | drug rehab azusa | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabissaquah.com | drug rehab issaquah | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtukwila.com | drug rehab tukwila | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabatwater.com | drug rehab atwater | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabrockcreek.com | drug rehab rock creek | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabastoria.com | drug rehab astoria | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| kantalukdesigns.com | kantaluk designs | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| avl-labs.com | avl labs | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabedwards.com | drug rehab edwards | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| myboycesma.com | my boyce sma | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabriolinda.com | drug rehab riolinda | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| familyconcern.com | family concern | 2010-08-04 | 2026-08-04 | 16 | Turncommerce, Inc. Dba Namebright.Com |
| xinluntools.com | xin lun tools | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabcedarhills.com | drug rehab cedar hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| goldstardiner.com | gold star diner | 2010-08-02 | 2026-08-02 | 16 | Register.Com – Network Solutions, Llc |
| norenttemecula.com | no rent temecula | 2010-08-03 | 2026-08-03 | 16 | Wild West Domains, Llc |
| sae-chadrac.com | sae chadrac | 2011-03-30 | 2027-03-30 | 16 | Orange |
| drugrehabmanhattanbeach.com | drug rehab manhattan beach | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmuscoy.com | drug rehab muscoy | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabliveoak.com | drug rehab live oak | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| hanridh.com | hanridh | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| silverballetflats.com | silver ballet flats | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehaboakley.com | drug rehab oakley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcoachella.com | drug rehab coachella | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfourcorners.com | drug rehab four corners | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabporterville.com | drug rehab porterville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| freeresumesamplesonline.com | free resume samples online | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| carpetcleaningsantanvalley.com | carpet cleaning santan valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| flightbitz.com | flight bitz | 2010-08-03 | 2026-08-03 | 16 | 123-Reg Limited |
| deltavalleyfarm.com | delta valley farm | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabbaypoint.com | drug rehab bay point | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| rickpagemusic.com | rick page music | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| 123-fuck.com | 123 fuck | 2010-08-02 | 2026-08-02 | 16 | Ionos Se |
| brendengreenwood.com | brenden greenwood | 2010-08-04 | 2026-08-04 | 16 | Tucows Domains Inc. |
| rezeptewerk.com | rezepte werk | 2010-08-05 | 2026-08-05 | 16 | Inwx Gmbh |
| aiposs.com | ai poss | 2010-08-02 | 2026-08-02 | 16 | Ionos Se |
| peak10fit.com | peak 10 fit | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| migliorihotelromagna.com | migliori hotel romagna | 2010-08-03 | 2026-08-03 | 16 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| drugrehabfruita.com | drug rehab fruita | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| thebrookwood79.com | the brookwood 79 | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabindio.com | drug rehab indio | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| bazienergy.com | bazi energy | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmadera.com | drug rehab madera | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| g-mecca.com | g mecca | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtanqueverde.com | drug rehab tanque verde | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwestpuentevalley.com | drug rehab west puente valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| tyhrkj.com | tyhrkj | 2010-08-04 | 2026-08-04 | 16 | NameSilo |
| beef-lamb.com | beef lamb | 2010-08-09 | 2026-08-09 | 16 | Regional Network Information Center, Jsc Dba Ru-Center |
| drugrehabwestlakestevens.com | drug rehab west lake stevens | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| maesinamaesina.com | maesina maesina | 2011-05-19 | 2027-05-19 | 16 | Orange |
| rickburpee.com | rick burpee | 2010-08-02 | 2026-08-02 | 16 | Register.Com – Network Solutions, Llc |
| drugrehabsuisuncity.com | drug rehab suisun city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmonterey.com | drug rehab monterey | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehaborland.com | drug rehab orland | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| luckydogreading.com | lucky dog reading | 2010-08-02 | 2026-08-02 | 16 | Domain.Com – Network Solutions, Llc |
| drugrehabartondale.com | drug rehab artondale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| securedatapayments.com | secure data payments | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| taxi93101.com | taxi 93101 | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmoraga.com | drug rehab moraga | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabloomis.com | drug rehab loomis | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbainbridgeisland.com | drug rehab bainbridge island | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdeserthotsprings.com | drug rehab desert hot springs | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsmithfield.com | drug rehab smithfield | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| rmhny.com | rmh ny | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| livingroomguitar.com | living room guitar | 2010-08-05 | 2026-08-05 | 16 | NameSilo |
| drugrehabpatterson.com | drug rehab patterson | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| wheredafoodtrucks.com | where da food trucks | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| liquidsunenergy.com | liquid sun energy | 2010-08-04 | 2026-08-04 | 16 | Easydns Technologies Inc. |
| phsindia.com | phs india | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbrynmawrskyway.com | drug rehab bryn mawr skyway | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabaltadena.com | drug rehab altadena | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| healthyhappyandholy.com | healthy happy and holy | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabyuccavalley.com | drug rehab yucca valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmentone.com | drug rehab mentone | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| trueyogapeace.com | true yoga peace | 2010-08-02 | 2026-08-02 | 16 | Network Solutions, Llc |
| drugrehabriodell.com | drug rehab rio dell | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabchehalis.com | drug rehab chehalis | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| bohemiabrilliant.com | bohemia brilliant | 2010-08-04 | 2026-08-04 | 16 | Tucows Domains Inc. |
| drugrehabalpine.com | drug rehab alpine | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabvernal.com | drug rehab vernal | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabnewriver.com | drug rehab new river | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| stoningtonpointpartners.com | stonington point partners | 2010-08-04 | 2026-08-04 | 16 | Wild West Domains, Llc |
| drugrehabwalnut.com | drug rehab walnut | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsnohomish.com | drug rehab snohomish | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehaborinda.com | drug rehab orinda | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| lillilondon.com | lilli london | 2010-08-05 | 2026-08-05 | 16 | Cloudflare, Inc. |
| emarketingxperts.com | e marketing xperts | 2010-08-02 | 2026-08-05 | 16 | NameSilo |
| drugrehabalondrapark.com | drug rehab alondra park | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsouthyubacity.com | drug rehab south yuba city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| shdetail.com | sh detail | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabcentralia.com | drug rehab centralia | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsantapaula.com | drug rehab santa paula | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| syndevgroup.com | syn dev group | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| barcelondon.com | barcelondon | 2010-08-11 | 2026-08-11 | 16 | Regional Network Information Center, Jsc Dba Ru-Center |
| drugrehabdelta.com | drug rehab delta | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwaller.com | drug rehab waller | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| cadomelimelo.com | cadomelimelo | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| ukamateurexhibitionist.com | uk amateur exhibitionist | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabpacifica.com | drug rehab pacifica | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabranchomirage.com | drug rehab rancho mirage | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabpicturerocks.com | drug rehab picture rocks | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabelcajon.com | drug rehab el cajon | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsantacruz.com | drug rehab santa cruz | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablosbanos.com | drug rehab los banos | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabparkcity.com | drug rehab park city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| paletten-aachen.com | paletten aachen | 2011-08-19 | 2027-08-19 | 16 | Mesh Digital Limited |
| lytdcq.com | lytdcq | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabcity.com | drug rehab city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| bearcanyondentistry.com | bear canyon dentistry | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| work4sbarro.com | work 4 sbarro | 2010-08-03 | 2026-08-03 | 16 | Dnc Holdings, Inc. |
| carlosoblivion.com | carlos oblivion | 2010-08-02 | 2026-08-02 | 16 | Domain.Com – Network Solutions, Llc |
| suzannegale.com | suzanne gale | 2010-11-06 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmiramonte.com | drug rehab miramonte | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsunnyside.com | drug rehab sunnyside | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcotodecaza.com | drug rehab coto de caza | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbanning.com | drug rehab banning | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfoothillranch.com | drug rehab foothill ranch | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbell.com | drug rehab bell | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| tidelandfarm.com | tideland farm | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabmiraloma.com | drug rehab mira loma | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| londonunee.com | london unee | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeastwenatcheebench.com | drug rehab east wenatchee bench | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabderby.com | drug rehab derby | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgrantsville.com | drug rehab grantsville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| highjinxproductions.com | high jinx productions | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| yourrightperson.com | your right person | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmissionviejo.com | drug rehab mission viejo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| balifurnituredecor.com | bali furniture decor | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabsouthogden.com | drug rehab south ogden | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| itsymail.com | itsy mail | 2011-08-09 | 2027-08-09 | 16 | GoDaddy |
| drugrehabchinovalley.com | drug rehab chino valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| samanthapersoff.com | samantha persoff | 2010-08-05 | 2026-08-05 | 16 | NameSilo |
| drugrehabhazeldellsouth.com | drug rehab hazel dell south | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeastfoothills.com | drug rehab east foothills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| penumbracoil.com | penumbra coil | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmanteca.com | drug rehab manteca | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| frankymaxclothing.com | franky max clothing | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcedarmill.com | drug rehab cedar mill | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| theprojuxts.com | the pro juxts | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabpalmdesert.com | drug rehab palm desert | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfarmersville.com | drug rehab farmersville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| lizlamcorp.com | liz lam corp | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabwestlakevillage.com | drug rehab westlake village | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| biz2serve.com | biz 2 serve | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| dragonsheadva.com | dragons head va | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeasthillmeridian.com | drug rehab east hill meridian | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabinglewoodfinnhill.com | drug rehab inglewood finn hill | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| omgsoboo.com | omg so boo | 2010-08-05 | 2026-08-05 | 16 | Eurodns S.A. |
| drugrehabwesthollywood.com | drug rehab west hollywood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabaltasierra.com | drug rehab alta sierra | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbigbearlake.com | drug rehab big bear lake | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabglobe.com | drug rehab globe | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbenicia.com | drug rehab benicia | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabunionhillnoveltyhill.com | drug rehab union hill novelty hill | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| holbrookacademy.com | holbrook academy | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablakelandnorth.com | drug rehab lakeland north | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| cakeangelsussex.com | cake angel sussex | 2010-08-04 | 2026-08-04 | 16 | Easyspace Limited |
| hbcfjzzs.com | hbcfjzzs | 2010-08-05 | 2026-08-05 | 16 | NameSilo |
| oglasi-mali.com | oglasi mali | 2010-08-05 | 2026-08-05 | 16 | NameSilo |
| drugrehabcrestline.com | drug rehab crestline | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsedona.com | drug rehab sedona | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| pfrnetwork.com | pfr network | 2010-08-04 | 2026-08-04 | 16 | Tucows Domains Inc. |
| drugrehabcalipatria.com | drug rehab calipatria | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| foodtrucksonline.com | food trucks online | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| leewelding.com | lee welding | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| piensadistinto.com | piensa distinto | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsutherlin.com | drug rehab sutherlin | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| remtexexport.com | rem tex export | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgreenwoodvillage.com | drug rehab greenwood village | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcanyonrim.com | drug rehab canyon rim | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabrossmoor.com | drug rehab rossmoor | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| gsmez.com | gsmez | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeloy.com | drug rehab eloy | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| allearefinancial.com | alleare financial | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| ipaintyoubuy.com | i paint you buy | 2010-08-05 | 2026-08-05 | 16 | Dynadot |
| aimazhe.com | ai ma zhe | 2010-08-07 | 2026-08-07 | 16 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| senateaccountabilitywatch.com | senate accountability watch | 2010-08-02 | 2026-08-02 | 16 | Network Solutions, Llc |
| amalamd.com | amalamd | 2010-08-01 | 2026-08-01 | 16 | Key-Systems Gmbh |
| drugrehabrosedale.com | drug rehab rosedale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| 173jfw.com | 173 jfw | 2010-08-13 | 2026-08-13 | 16 | Hefei Juming Network Technology Co., Ltd |
| drugrehabaptos.com | drug rehab aptos | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabchowchilla.com | drug rehab chowchilla | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabquartzhill.com | drug rehab quartz hill | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabevergreen.com | drug rehab evergreen | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| omgboo.com | omg boo | 2010-08-05 | 2026-08-05 | 16 | Eurodns S.A. |
| drugrehabgroverbeach.com | drug rehab grover beach | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| ireckonhosting.com | i reckon hosting | 2010-08-02 | 2026-08-02 | 16 | Key-Systems Gmbh |
| misicmasonry.com | misic masonry | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabearlimart.com | drug rehab earlimart | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabclearlake.com | drug rehab clear lake | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabstayton.com | drug rehab stayton | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeasthemet.com | drug rehab east hemet | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| wishart-projects.com | wishart projects | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| vacationnicaragua.com | vacation nicaragua | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| zgkclaw.com | zgk claw | 2010-08-02 | 2026-08-02 | 16 | Bluehost Inc. |
| drugrehabmukilteo.com | drug rehab mukilteo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| johogets.com | joho gets | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabtoppenish.com | drug rehab toppenish | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcarpinteria.com | drug rehab carpinteria | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhurricane.com | drug rehab hurricane | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| yzhobby.com | yz hobby | 2010-08-06 | 2026-08-06 | 16 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| drugrehabfoothillfarms.com | drug rehab foothill farms | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| herpleasureshared.com | her pleasure shared | 2010-08-02 | 2026-08-02 | 16 | Domain.Com – Network Solutions, Llc |
| xytsvw.com | xytsvw | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabgalt.com | drug rehab galt | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| pgc-atl.com | pgc atl | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| deniselipusch.com | denise lipusch | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| d2gproductions.com | d 2 g productions | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabfairoaks.com | drug rehab fair oaks | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabprineville.com | drug rehab prineville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabvallevista.com | drug rehab valle vista | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcamppendletonsouth.com | drug rehab camp pendleton south | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| cashincn.com | cash in cn | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabmonmouth.com | drug rehab monmouth | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcolton.com | drug rehab colton | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabelsobrante.com | drug rehab el sobrante | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| mzhouyi.com | m zhou yi | 2010-08-14 | 2026-08-14 | 16 | Chengdu Fly-Digital Technology Co., Ltd. |
| remibykim.com | remi by kim | 2010-09-14 | 2026-09-14 | 16 | GoDaddy |
| blackoutwcc.com | blackout wcc | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| superbolli.com | super bolli | 2011-02-14 | 2027-02-14 | 16 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| drugrehabmarthalake.com | drug rehab martha lake | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| hangjungsa.com | hang jung sa | 2010-08-06 | 2026-08-06 | 16 | Gabia, Inc. |
| wrapevansville.com | wrap evansville | 2010-08-02 | 2026-08-02 | 16 | Epik Llc |
| drugrehabelcentro.com | drug rehab el centro | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| nestredesigns.com | nestre designs | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabkingcity.com | drug rehab king city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| scoriapharmaceuticals.com | scoria pharmaceuticals | 2010-08-03 | 2026-08-03 | 16 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| drugrehabtruckee.com | drug rehab truckee | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsandiegocountryestates.com | drug rehab san diego country estates | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| sandramathia.com | sandra mathia | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtubacity.com | drug rehab tuba city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablakeforestpark.com | drug rehab lake forest park | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgardenhomewhitford.com | drug rehab garden home whitford | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwildomar.com | drug rehab wildomar | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmoseslake.com | drug rehab moses lake | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgoldriver.com | drug rehab gold river | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfountainvalley.com | drug rehab fountain valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabrowlandheights.com | drug rehab rowland heights | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| houseoflordclothing.com | house of lord clothing | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| levisvilledurock.com | levis ville du rock | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablacrescentamontrose.com | drug rehab la crescenta montrose | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhercules.com | drug rehab hercules | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| t1dx.com | t 1 dx | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabthermalito.com | drug rehab thermalito | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwestcarson.com | drug rehab west carson | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| industrie-service-raeren.com | industrie service raeren | 2011-08-19 | 2027-08-19 | 16 | Mesh Digital Limited |
| drugrehablakelandsouth.com | drug rehab lakeland south | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbigbearcity.com | drug rehab big bear city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbarstow.com | drug rehab barstow | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhanford.com | drug rehab hanford | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabartesia.com | drug rehab artesia | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| axiome-lam.com | axiome lam | 2010-12-01 | 2026-12-01 | 16 | Orange |
| teampocono.com | team pocono | 2010-08-04 | 2026-08-04 | 16 | Wild West Domains, Llc |
| drugrehabcampverde.com | drug rehab camp verde | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmammothlakes.com | drug rehab mammoth lakes | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfolsom.com | drug rehab folsom | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| mybusinesscoachparishataylor.com | my business coach parisha taylor | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanmarino.com | drug rehab san marino | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| aysenkara.com | aysen kara | 2010-08-09 | 2026-08-09 | 16 | Ionos Se |
| drugrehabellensburg.com | drug rehab ellensburg | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcamano.com | drug rehab camano | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwalnutpark.com | drug rehab walnut park | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanclemente.com | drug rehab san clemente | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabnewman.com | drug rehab newman | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| ntb-dz.com | ntb dz | 2010-08-04 | 2026-08-04 | 16 | Dynadot |
| drugrehabshastalake.com | drug rehab shasta lake | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdouglas.com | drug rehab douglas | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| holiday-gift-cards.com | holiday gift cards | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanramon.com | drug rehab san ramon | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablaughlin.com | drug rehab laughlin | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablakeelsinore.com | drug rehab lake elsinore | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtiburon.com | drug rehab tiburon | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabreedley.com | drug rehab reedley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| rejuvinateyourvagina.com | rejuvinate your vagina | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbisbee.com | drug rehab bisbee | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| otohasaronarim.com | otohasaronarim | 2010-08-04 | 2026-08-04 | 16 | Çizgi Telekomunikasyon A.Ş. |
| drugrehabwinnemucca.com | drug rehab winnemucca | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabheber.com | drug rehab heber | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| globaltorchlight.com | global torchlight | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| blackboxbar.com | black box bar | 2010-08-02 | 2026-08-02 | 16 | Network Solutions, Llc |
| drugrehabgoleta.com | drug rehab goleta | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablaquinta.com | drug rehab la quinta | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcamppendletonnorth.com | drug rehab camp pendleton north | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| guccikit.com | gucci kit | 2010-08-05 | 2026-08-05 | 16 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| drugrehabgoldcamp.com | drug rehab gold camp | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| eurocord-ed.com | euro cord ed | 2010-08-03 | 2026-08-03 | 16 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| drugrehabsanmarcos.com | drug rehab san marcos | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| reefoid.com | reefoid | 2010-08-03 | 2026-08-03 | 16 | 123-Reg Limited |
| ehpah-la-rouviere.com | ehpah la rouviere | 2010-09-08 | 2026-09-08 | 16 | Orange |
| summerlandenergy.com | summerland energy | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| dtfjdz.com | dtfjdz | 2010-08-14 | 2026-08-14 | 16 | Gname.Com Pte. Ltd. |
| ssnade.com | ssnade | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| metropolitanvillageapts.com | metropolitan village apts | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabfederalheights.com | drug rehab federal heights | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablomalinda.com | drug rehab loma linda | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| mackayfinancial.com | mackay financial | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabapplewood.com | drug rehab applewood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabpismobeach.com | drug rehab pismo beach | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsecuritywidefield.com | drug rehab security widefield | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabranchopalosverdes.com | drug rehab rancho palos verdes | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| cannaholic.com | cannaholic | 2010-01-12 | 2026-08-05 | 16 | Dynadot |
| automaticbreadmaker.com | automatic bread maker | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfallbrook.com | drug rehab fallbrook | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabripon.com | drug rehab ripon | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabpueblowest.com | drug rehab pueblo west | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| archivoylogistica.com | archivo y logistica | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| fantasycarrentals.com | fantasy car rentals | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabpiedmont.com | drug rehab piedmont | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablakeside.com | drug rehab lakeside | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabnewkingmanbutler.com | drug rehab new kingman butler | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| clinicdrug.com | clinic drug | 2010-10-08 | 2026-10-08 | 16 | Amazon Registrar, Inc. |
| drugrehabkenmore.com | drug rehab kenmore | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabculvercity.com | drug rehab culver city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| jsszdjzs.com | jsszdjzs | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabpalmsprings.com | drug rehab palm springs | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| hansgp.com | hans gp | 2010-08-06 | 2026-08-06 | 16 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| drugrehabagourahills.com | drug rehab agoura hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmoorpark.com | drug rehab moorpark | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsafford.com | drug rehab safford | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| mymauiwowie.com | my maui wowie | 2010-11-05 | 2026-11-05 | 16 | GoDaddy |
| lithiumborate.com | lithium borate | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| alphaprocure.com | alpha procure | 2010-08-02 | 2026-08-02 | 16 | Bluehost Inc. |
| drugrehabvashon.com | drug rehab vashon | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| floresbachperu.com | flores bach peru | 2010-10-05 | 2026-10-05 | 16 | Infomaniak Network Sa |
| drugrehabcanyonlake.com | drug rehab canyon lake | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbonneylake.com | drug rehab bonney lake | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablariviera.com | drug rehab la riviera | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| efinancialplanningsystems.com | e financial planning systems | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcovina.com | drug rehab covina | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcoalinga.com | drug rehab coalinga | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabelrio.com | drug rehab el rio | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtehachapi.com | drug rehab tehachapi | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| crystalcoverealtor.com | crystal cove realtor | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| vertrucks.com | ver trucks | 2010-08-03 | 2026-08-03 | 16 | Enom, Llc |
| apathtowellnessllc.com | a path to wellness llc | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabplacentia.com | drug rehab placentia | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| saudimatrimony.com | saudi matrimony | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwinslow.com | drug rehab winslow | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| sufferingsoul.com | suffering soul | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabcentralpoint.com | drug rehab central point | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| sheademolition.com | shea demolition | 2010-08-03 | 2026-08-03 | 16 | Dnc Holdings, Inc. |
| drugrehablagunawoods.com | drug rehab laguna woods | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| parrotwiki.com | parrot wiki | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcamas.com | drug rehab camas | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabpicnicpointnorthlynnwood.com | drug rehab picnic point north lynnwood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabshafter.com | drug rehab shafter | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabspringcreek.com | drug rehab spring creek | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdiamondbar.com | drug rehab diamond bar | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| teamroompolis.com | team room polis | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| resumebuildingworkbook.com | resume building workbook | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| bohemia-brilliant.com | bohemia brilliant | 2010-08-04 | 2026-08-04 | 16 | Tucows Domains Inc. |
| wildcherrybombshells.com | wild cherry bombshells | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwashougal.com | drug rehab washougal | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwestrichland.com | drug rehab west richland | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmountlaketerrace.com | drug rehab mountlake terrace | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbermudadunes.com | drug rehab bermuda dunes | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehaboroville.com | drug rehab oroville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfairview.com | drug rehab fairview | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| cancm.com | cancm | 2012-05-09 | 2028-05-09 | 16 | GoDaddy |
| drugrehabmorrobay.com | drug rehab morro bay | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| increaseyourluck.com | increase your luck | 2010-08-04 | 2026-08-04 | 16 | Turncommerce, Inc. Dba Namebright.Com |
| forty8backpackers.com | forty 8 backpackers | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| omgsoboohoo.com | omg so boohoo | 2010-08-05 | 2026-08-05 | 16 | Eurodns S.A. |
| drugrehabprunedale.com | drug rehab prunedale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablathrop.com | drug rehab lathrop | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| profseconline.com | prof sec online | 2010-08-03 | 2026-08-03 | 16 | Enom, Llc |
| sunsteinholdings.com | sunstein holdings | 2010-08-02 | 2026-08-02 | 16 | Network Solutions, Llc |
| muscatdating.com | muscat dating | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcompton.com | drug rehab compton | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcheney.com | drug rehab cheney | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmcfarland.com | drug rehab mcfarland | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| 139gs.com | 139 gs | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabgilroy.com | drug rehab gilroy | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| acodastudios.com | acoda studios | 2010-09-17 | 2026-09-17 | 16 | Registrygate Gmbh |
| isol-habitat.com | isol habitat | 2011-05-27 | 2027-05-27 | 16 | Orange |
| drugrehablakestevens.com | drug rehab lake stevens | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhawaiiangardens.com | drug rehab hawaiian gardens | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| omgboohoo.com | omg boohoo | 2010-08-05 | 2026-08-05 | 16 | Eurodns S.A. |
| bearwallowevents.com | bear wallow events | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| performanceappraisalllc.com | performance appraisal llc | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| plateriadival.com | plateria dival | 2010-08-02 | 2026-08-02 | 16 | Ionos Se |
| drugrehabmissionhills.com | drug rehab mission hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabglenavon.com | drug rehab glenavon | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| sonyadesandro.com | sonya desandro | 2010-08-03 | 2026-08-03 | 16 | Wild West Domains, Llc |
| assortedyouth.com | assorted youth | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcityof.com | drug rehab city of | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| bangninji.com | bang nin ji | 2010-08-12 | 2026-08-12 | 16 | Bizcn.Com, Inc. |
| drugrehabsouthsanjosehills.com | drug rehab south san jose hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbrier.com | drug rehab brier | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| tuloenvias.com | tulo envias | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwoodinville.com | drug rehab woodinville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwinters.com | drug rehab winters | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| emmchenswelt.com | emmchens welt | 2010-10-11 | 2026-10-11 | 16 | Key-Systems Gmbh |
| resumepowerwords.com | resume power words | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablakelosangeles.com | drug rehab lake los angeles | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| santanvalleyproperty.com | san tan valley property | 2010-11-05 | 2026-11-05 | 16 | GoDaddy |
| independentrestaurantsolutions.com | independent restaurant solutions | 2010-08-05 | 2026-08-05 | 16 | NameSilo |
| drugrehablindon.com | drug rehab lindon | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| blenkinsopsewmachinerepair.com | blenkinsop sew machine repair | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| 51duixiang.com | 51 duixiang | 2010-08-06 | 2026-08-06 | 16 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| drugrehabcalimesa.com | drug rehab calimesa | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabelkplain.com | drug rehab elk plain | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablamar.com | drug rehab lamar | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsolvang.com | drug rehab solvang | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabfortuna.com | drug rehab fortuna | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablosaltos.com | drug rehab los altos | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwalnutgrove.com | drug rehab walnut grove | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| 0352g.com | 0352 g | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabranchocordova.com | drug rehab rancho cordova | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| cyxypg.com | cyxypg | 2010-08-14 | 2026-08-14 | 16 | Gname.Com Pte. Ltd. |
| drugrehabriodelmar.com | drug rehab rio del mar | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| urbansuburbanantiques.com | urban suburban antiques | 2010-08-01 | 2026-08-01 | 16 | Domain Science Kutatási Szolgáltató Korlátolt Felelősségű Társaság |
| drugrehabsausalito.com | drug rehab sausalito | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| pashakhanjutin.com | pasha khanjutin | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmaltby.com | drug rehab maltby | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| bootlegcomic.com | bootleg comic | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| the-top-of-tops.com | the top of tops | 2010-08-02 | 2026-08-02 | 16 | Key-Systems Gmbh |
| drugrehablarkfieldwikiup.com | drug rehab larkfield wikiup | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| freeboycesma.com | free boyces ma | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| wcbehavioural.com | wc behavioural | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabalisoviejo.com | drug rehab aliso viejo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| bootlegcomics.com | bootleg comics | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| wearemagenta.com | we are magenta | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| prowrestlingfundraiser.com | pro wrestling fundraiser | 2010-11-04 | 2026-11-04 | 16 | GoDaddy |
| designbettersystems.com | design better systems | 2011-01-17 | 2027-01-17 | 16 | GoDaddy |
| drugrehabfruitvale.com | drug rehab fruitvale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| chicagolegalgroup.com | chicago legal group | 2010-08-03 | 2026-08-03 | 16 | Ionos Se |
| drugrehabwestsacramento.com | drug rehab west sacramento | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| thegreatnebraskabeerfest.com | the great nebraska beer fest | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| eagleflighttechnics.com | eagle flight technics | 2010-08-02 | 2026-08-02 | 16 | Key-Systems Gmbh |
| drugrehabrosemead.com | drug rehab rosemead | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanpablo.com | drug rehab san pablo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehaborosi.com | drug rehab orosi | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtumwater.com | drug rehab tumwater | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| juanherman.com | juan herman | 2010-08-03 | 2026-08-03 | 16 | 123-Reg Limited |
| drugrehabwasco.com | drug rehab wasco | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablagunawestlakeside.com | drug rehab laguna west lakeside | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcloverdale.com | drug rehab cloverdale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbrighamcity.com | drug rehab brigham city | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbrawley.com | drug rehab brawley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| resumeformattingtips.com | resume formatting tips | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| zunhuajob.com | zunhua job | 2010-08-14 | 2026-08-14 | 16 | Gname.Com Pte. Ltd. |
| shtampabay.com | shtampa bay | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablagunahills.com | drug rehab laguna hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| kuboshashinkan.com | kubo sha shinkan | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsolanabeach.com | drug rehab solana beach | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| fromnaturesview.com | from natures view | 2010-08-04 | 2026-08-04 | 16 | Tucows Domains Inc. |
| drugrehabsebastopol.com | drug rehab sebastopol | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsouthwhittier.com | drug rehab south whittier | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| domainconnects.com | domain connects | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| txjsj88.com | txjsj 88 | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabwestmont.com | drug rehab westmont | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| thebeachmassage.com | the beach massage | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| blueflamecreativegroup.com | blue flame creative group | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsalmoncreek.com | drug rehab salmon creek | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcraig.com | drug rehab craig | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| yahbooks.com | yah books | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| arabianromance.com | arabian romance | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabnormandypark.com | drug rehab normandy park | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| destinbestbeachrentals.com | destin best beach rentals | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwoodland.com | drug rehab woodland | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhalfmoonbay.com | drug rehab half moon bay | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| birthday-giftcard.com | birthday gift card | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabimperialbeach.com | drug rehab imperial beach | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwindsor.com | drug rehab windsor | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwatsonville.com | drug rehab watsonville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| pinzillacchera.com | pinzillacchera | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| caricomer.com | cari comer | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabsoledad.com | drug rehab soledad | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| omgohsoboohoo.com | omg oh so boohoo | 2010-08-05 | 2026-08-05 | 16 | Eurodns S.A. |
| drugrehabparlier.com | drug rehab parlier | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabranchosandiego.com | drug rehab rancho san diego | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabpleasanthill.com | drug rehab pleasant hill | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| bedtimescience.com | bedtime science | 2010-08-03 | 2026-08-03 | 16 | Ionos Se |
| drugrehabcerritos.com | drug rehab cerritos | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgardnervilleranchos.com | drug rehab gardnerville ranchos | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabpainefieldlakestickney.com | drug rehab paine field lake stickney | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabamericancanyon.com | drug rehab american canyon | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabpetaluma.com | drug rehab petaluma | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmanitousprings.com | drug rehab manitou springs | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwoodscross.com | drug rehab woods cross | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| nmjcqc.com | nmjcqc | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| pairuihotel.com | pai rui hotel | 2010-08-06 | 2026-08-06 | 16 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| birdnestghouse.com | bird nest g house | 2010-08-05 | 2026-08-05 | 16 | Web Commerce Communications Limited Dba Webnic.Cc |
| drugrehabgoldenhills.com | drug rehab golden hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeastpaloalto.com | drug rehab east palo alto | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsalida.com | drug rehab salida | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhazeldellnorth.com | drug rehab hazel dell north | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| labcheen.com | lab cheen | 2010-08-03 | 2026-08-03 | 16 | Enom, Llc |
| tonyguntermann.com | tony guntermann | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabatascadero.com | drug rehab atascadero | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| fbs888.com | fbs 888 | 2010-08-14 | 2026-08-14 | 16 | Gname.Com Pte. Ltd. |
| adabkadeh.com | adab kadeh | 2010-08-03 | 2026-08-03 | 16 | Dreamhost, Llc |
| drugrehabmendota.com | drug rehab mendota | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| besttreadmillsforhome.com | best treadmills for home | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| kyriad-confluence.com | kyriad confluence | 2011-05-26 | 2027-05-26 | 16 | Orange |
| caitlinmoorearchitect.com | caitlin moore architect | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablaverne.com | drug rehab la verne | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| royehartlaw.com | roye hart law | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcarmelbythesea.com | drug rehab carmel by the sea | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeastcompton.com | drug rehab east compton | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabvalleycenter.com | drug rehab valley center | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| megpontecorvo.com | meg pontecorvo | 2010-08-03 | 2026-08-03 | 16 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| drugrehabpacificgrove.com | drug rehab pacific grove | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmorganhill.com | drug rehab morgan hill | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| astyldlife.com | astyld life | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| thetentking.com | the tent king | 2010-08-05 | 2026-08-05 | 16 | NameSilo |
| drugrehabpalosverdesestates.com | drug rehab palos verdes estates | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| harpersenterprise.com | harpers enterprise | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablagrande.com | drug rehab la grande | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| calhounleadershipscholarship.com | calhoun leadership scholarship | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabplacerville.com | drug rehab placerville | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmonrovia.com | drug rehab monrovia | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| hackensackchiro.com | hackensack chiro | 2010-08-02 | 2026-08-02 | 16 | Register.Com – Network Solutions, Llc |
| drugrehabturlock.com | drug rehab turlock | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| glitteraticoncierge.com | glitterati concierge | 2010-05-12 | 2026-08-04 | 16 | GoDaddy |
| drugrehabcollegeplace.com | drug rehab college place | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| homesearchinlongmont.com | home search in longmont | 2010-07-27 | 2026-08-03 | 16 | GoDaddy |
| aglimpseofbeautiful.com | a glimpse of beautiful | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabkingsgate.com | drug rehab kingsgate | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| resellgalore.com | resell galore | 2010-08-05 | 2026-08-05 | 16 | NameSilo |
| drugrehabnipomo.com | drug rehab nipomo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| brucecareylaw.com | bruce carey law | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| sportmenshub.com | sport mens hub | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| frahmcos.com | frahm cos | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwestwood.com | drug rehab westwood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehaborovilleeast.com | drug rehab oroville east | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbangortridentbase.com | drug rehab bangor trident base | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| nitroxholdings.com | nitrox holdings | 2010-08-01 | 2026-08-01 | 16 | Name.Com, Inc. |
| drugrehabwinton.com | drug rehab winton | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| poontangenergydrink.com | poontang energy drink | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanbruno.com | drug rehab san bruno | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| torresgrp.com | torres grp | 2010-11-04 | 2026-11-04 | 16 | GoDaddy |
| drugrehaborchardmesa.com | drug rehab orchard mesa | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| wheeliesafe.com | wheelie safe | 2010-08-02 | 2026-08-02 | 16 | Key-Systems Gmbh |
| resumebuildingtips.com | resume building tips | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablosaltoshills.com | drug rehab los altos hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdurango.com | drug rehab durango | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabnorthsaltlake.com | drug rehab north salt lake | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| allforjesuslivingwaters.com | all for jesus living waters | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabterraceheights.com | drug rehab terrace heights | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcalabasas.com | drug rehab calabasas | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgunbarrel.com | drug rehab gun barrel | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| kashishenterprises.com | kashish enterprises | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| wizardtakesall.com | wizard takes all | 2010-08-02 | 2026-08-02 | 16 | Domain.Com – Network Solutions, Llc |
| divorceandcustodyhelp.com | divorce and custody help | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtamalpaishomesteadvalley.com | drug rehab tamalpais homestead valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablompoc.com | drug rehab lompoc | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsangabriel.com | drug rehab san gabriel | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmarina.com | drug rehab marina | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabadelanto.com | drug rehab adelanto | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabgolden.com | drug rehab golden | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanjacinto.com | drug rehab san jacinto | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabpoway.com | drug rehab poway | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| devonholidaycaravan.com | devon holiday caravan | 2010-08-03 | 2026-08-03 | 16 | Enom, Llc |
| wabsystems.com | wab systems | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabojai.com | drug rehab ojai | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| resumebuildingchecklist.com | resume building checklist | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablosalamitos.com | drug rehab los alamitos | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| tamardresner.com | tamar dresner | 2010-08-02 | 2026-08-02 | 16 | Bluehost Inc. |
| drugrehabarcata.com | drug rehab arcata | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabparkwood.com | drug rehab parkwood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabredbluff.com | drug rehab red bluff | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanrafael.com | drug rehab san rafael | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabseattlehillsilverfirs.com | drug rehab seattle hill silver firs | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| itbusinesswriter.com | it business writer | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabportorchard.com | drug rehab port orchard | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| pcpcomunicaciones.com | pcp comunicaciones | 2010-08-03 | 2026-08-03 | 16 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| selllongmonthomes.com | sell longmont homes | 2010-07-27 | 2026-08-03 | 16 | GoDaddy |
| appliedboredom.com | applied boredom | 2010-08-03 | 2026-08-03 | 16 | Wild West Domains, Llc |
| drugrehabberkley.com | drug rehab berkley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| playcoolguitar.com | play cool guitar | 2010-08-02 | 2026-08-02 | 16 | Bluehost Inc. |
| drugrehabeastsangabriel.com | drug rehab east san gabriel | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablarkspur.com | drug rehab larkspur | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabolivehurst.com | drug rehab olivehurst | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabimperial.com | drug rehab imperial | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| hsiaokueili.com | hsiao kuei li | 2010-08-05 | 2026-08-05 | 16 | NameSilo |
| drugrehabcanby.com | drug rehab canby | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| hypermediamarketing.com | hyper media marketing | 2010-08-09 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcascadefairwood.com | drug rehab cascade fairwood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| dingsvision.com | dings vision | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| berbercarpetbible.com | berber carpet bible | 2010-08-02 | 2026-08-02 | 16 | Namecheap |
| drugrehabwoodcrest.com | drug rehab woodcrest | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsananselmo.com | drug rehab san anselmo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| claradesandro.com | clara desandro | 2010-08-03 | 2026-08-03 | 16 | Wild West Domains, Llc |
| drugrehaboakgrove.com | drug rehab oak grove | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| beautifulramifications.com | beautiful ramifications | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwestpoint.com | drug rehab west point | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabriverbank.com | drug rehab riverbank | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| michelle-a.com | michelle a | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeastlamirada.com | drug rehab east la mirada | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsunlakes.com | drug rehab sun lakes | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabvalinda.com | drug rehab valinda | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabislavista.com | drug rehab isla vista | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablaguna.com | drug rehab laguna | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| mudancasalvador.com | mudancasalvador | 2010-08-03 | 2026-08-03 | 16 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| jmphotovideo.com | jm photo video | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcoronado.com | drug rehab coronado | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| chateau-de-seguin.com | chateau de seguin | 2010-10-04 | 2026-10-04 | 16 | Orange |
| mdconnectmylife.com | md connect my life | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwhitecenter.com | drug rehab white center | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| littleonionrestaurant.com | little onion restaurant | 2010-11-04 | 2026-11-04 | 16 | GoDaddy |
| zhaobaojie.com | zhao bao jie | 2010-08-08 | 2026-08-08 | 16 | 22Net, Inc. |
| drugrehabevans.com | drug rehab evans | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| yourmckesson.com | your mckesson | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| greenelectricalcontractors.com | green electrical contractors | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| istanbulkiralama.com | istanbul kiralama | 2010-08-04 | 2026-08-04 | 16 | Ihs Telekom, Inc. |
| drugrehabexeter.com | drug rehab exeter | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| garynorthinstitute.com | gary north institute | 2010-08-02 | 2026-08-02 | 16 | Porkbun Llc |
| drugrehablacanadaflintridge.com | drug rehab la canada flintridge | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehaborcutt.com | drug rehab orcutt | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsanlorenzo.com | drug rehab san lorenzo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabvista.com | drug rehab vista | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| partandparcelfurniture.com | part and parcel furniture | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| nicepriceprints.com | nice price prints | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| hftjhome.com | hftj home | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehaborangecove.com | drug rehab orange cove | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcudahy.com | drug rehab cudahy | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| 100milebarbeque.com | 100 mile barbeque | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmaderaacres.com | drug rehab madera acres | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabalamosa.com | drug rehab alamosa | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| floridaconstructionlawauthority.com | florida construction law authority | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| exerciseslosingweight.com | exercises losing weight | 2010-08-03 | 2026-08-03 | 16 | Namecheap |
| drugrehabholladay.com | drug rehab holladay | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabdishman.com | drug rehab dishman | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabanacortes.com | drug rehab anacortes | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| rocklandcountymoldtesting.com | rockland county mold testing | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| macwardscompatible.com | mac wards compatible | 2010-08-02 | 2026-08-02 | 16 | Domain.Com – Network Solutions, Llc |
| drugrehabcottonwood.com | drug rehab cottonwood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| hollimanpa.com | holliman pa | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsumner.com | drug rehab sumner | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablapalma.com | drug rehab la palma | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablindsay.com | drug rehab lindsay | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehaborchards.com | drug rehab orchards | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabukiah.com | drug rehab ukiah | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabkelso.com | drug rehab kelso | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwrightwood.com | drug rehab wrightwood | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcherryland.com | drug rehab cherryland | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwoodmoor.com | drug rehab woodmoor | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| siddharthathebuddha.com | siddhartha the buddha | 2010-08-02 | 2026-08-02 | 16 | Bluehost Inc. |
| dreamcliquellc.com | dream clique llc | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| wnyrheumatologycenter.com | wny rheumatology center | 2010-08-04 | 2026-08-04 | 16 | Tucows Domains Inc. |
| drugrehablawndale.com | drug rehab lawndale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| 512happyhour.com | 512 happy hour | 2010-08-02 | 2026-08-02 | 16 | Ionos Se |
| teamciclo.com | team ciclo | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| ghostoceanmagazine.com | ghost ocean magazine | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehaboildale.com | drug rehab oildale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabeldoradohills.com | drug rehab el dorado hills | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcountryclub.com | drug rehab country club | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| sanyaboat.com | sanya boat | 2010-08-14 | 2026-08-14 | 16 | Gname.Com Pte. Ltd. |
| drugrehaborangevale.com | drug rehab orangevale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtwinlakes.com | drug rehab twin lakes | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| adams-technologie.com | adams technologie | 2010-10-28 | 2026-10-28 | 16 | Orange |
| drugrehabvincent.com | drug rehab vincent | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcortemadera.com | drug rehab corte madera | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| mancinosforum.com | mancinos forum | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| olebyfm.com | ole by fm | 2010-08-05 | 2026-08-05 | 16 | Dinahosting S.L. |
| investinproductivity.com | invest in productivity | 2010-08-02 | 2026-08-02 | 16 | Network Solutions, Llc |
| drugrehabthepinery.com | drug rehab the pinery | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| sportmanshub.com | sport mans hub | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmillplain.com | drug rehab mill plain | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsouthsangabriel.com | drug rehab south san gabriel | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| findlaygoldenfarms.com | findlay golden farms | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabotisorchardseastfarms.com | drug rehab otis orchards east farms | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| hbydbc.com | hbydbc | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| dorkdiarys.com | dork diarys | 2010-08-03 | 2026-08-03 | 16 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| drugrehabcommerce.com | drug rehab commerce | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabtwentyninepalms.com | drug rehab twenty nine palms | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcottonwoodverdevillage.com | drug rehab cottonwood verde village | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabrocklin.com | drug rehab rocklin | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| luizhenriqueamorim.com | luiz henrique amorim | 2010-08-04 | 2026-08-04 | 16 | Tucows Domains Inc. |
| drugrehabfernley.com | drug rehab fernley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhoquiam.com | drug rehab hoquiam | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| supportingtechnology.com | supporting technology | 2010-08-02 | 2026-08-02 | 16 | Enom, Llc |
| drugrehabrohnertpark.com | drug rehab rohnert park | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabardenarcade.com | drug rehab arden arcade | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| theburnins.com | the burn ins | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabcornelius.com | drug rehab cornelius | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| longtengjichu.com | long teng ji chu | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabselma.com | drug rehab selma | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| seaconestate.com | sea con estate | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabclayton.com | drug rehab clayton | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmontrose.com | drug rehab montrose | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| capoeira-stuttgart.com | capoeira stuttgart | 2010-08-04 | 2026-08-04 | 16 | Interdominios, Inc. |
| signsofsanluisobispo.com | signs of san luis obispo | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| billyarcade.com | billy arcade | 2010-08-04 | 2026-08-04 | 16 | GoDaddy |
| drugrehabforestgrove.com | drug rehab forest grove | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| earlylearningforum.com | early learning forum | 2010-08-04 | 2026-08-04 | 16 | Wild West Domains, Llc |
| drugrehabgranitebay.com | drug rehab granite bay | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabopalcliffs.com | drug rehab opal cliffs | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabmillvalley.com | drug rehab mill valley | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| themedutygroup.com | the meduty group | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabburlingame.com | drug rehab burlingame | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| tcregan.com | tc regan | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabwillows.com | drug rehab willows | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| onlyfordocs.com | only for docs | 2010-08-01 | 2026-08-01 | 16 | Ionos Se |
| austrian-fishing.com | austrian fishing | 2011-04-06 | 2027-04-06 | 16 | Key-Systems Gmbh |
| margueriteyoung.com | marguerite young | 2010-08-02 | 2026-08-02 | 16 | Ionos Se |
| granitegrandrapids.com | granite grand rapids | 2010-08-02 | 2026-08-02 | 16 | Enom, Llc |
| drugrehablakeshore.com | drug rehab lakeshore | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabhaciendaheights.com | drug rehab hacienda heights | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| equalityca.com | equality ca | 2010-08-05 | 2026-08-05 | 16 | NameSilo |
| xiaosantong.com | xiao san tong | 2010-08-14 | 2026-08-14 | 16 | Gname.Com Pte. Ltd. |
| drugrehabsealbeach.com | drug rehab seal beach | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| susielarsson.com | susie larsson | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| mtnvalleystone.com | mtn valley stone | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabporthueneme.com | drug rehab port hueneme | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehablagunabeach.com | drug rehab laguna beach | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabglenwoodsprings.com | drug rehab glenwood springs | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehaboceano.com | drug rehab oceano | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbellgardens.com | drug rehab bell gardens | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabbattleground.com | drug rehab battle ground | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| maxentaplus.com | maxenta plus | 2010-08-05 | 2026-08-05 | 16 | Web Commerce Communications Limited Dba Webnic.Cc |
| artsallover.com | arts all over | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabriverdale.com | drug rehab riverdale | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabparamount.com | drug rehab paramount | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| forecastertest.com | forecaster test | 2010-08-03 | 2026-08-03 | 16 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| drugrehabclarkstonheightsvineland.com | drug rehab clarkston heights vineland | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| drugrehabsouthelmonte.com | drug rehab south el monte | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| soundupshop.com | sound up shop | 2010-08-09 | 2026-08-09 | 16 | Regional Network Information Center, Jsc Dba Ru-Center |
| shuyuanrenjia.com | shu yuan ren jia | 2010-08-13 | 2026-08-13 | 16 | Gname.Com Pte. Ltd. |
| drugrehabsaratoga.com | drug rehab saratoga | 2010-08-03 | 2026-08-03 | 16 | GoDaddy |
| ernieshomeloans.com | ernies home loans | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| koolina-e.com | koolina e | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| newgzr.com | newgzr | 2011-08-14 | 2026-08-14 | 15 | Gname.Com Pte. Ltd. |
| scholasticsolutions.com | scholastic solutions | 2011-08-02 | 2026-08-02 | 15 | Azdomainz, Llc |
| activitiesreview.com | activities review | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| derekhauserdentist.com | derek hauser dentist | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| apacmagazine.com | apac magazine | 2011-08-03 | 2026-08-03 | 15 | Network Solutions, Llc |
| jesuites-csf.com | jesuites csf | 2011-08-02 | 2026-08-02 | 15 | Bluehost Inc. |
| customersm.com | customer sm | 2011-08-04 | 2026-08-04 | 15 | Domeneshop As Dba Domainnameshop.Com |
| nwazet.com | nwazet | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| courtneysteffensphotography.com | courtney steffens photography | 2011-08-05 | 2026-08-05 | 15 | Pair Networks, Inc. D/B/A Pair Domains |
| 18wheelsofhorror.com | 18 wheels of horror | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| tiideal.com | tiideal | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| businessplan-profi.com | business plan profi | 2011-08-01 | 2026-08-01 | 15 | United-Domains Gmbh |
| jbsteas.com | jbs teas | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| toyanimations.com | toy animations | 2011-08-02 | 2026-08-02 | 15 | Sea Wasp, Llc |
| maroonedthetransformation.com | marooned the transformation | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| qatarworldcup2022.com | qatar world cup 2022 | 2011-08-03 | 2026-08-03 | 15 | Wild West Domains, Llc |
| howletthealth.com | howlett health | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| l12funds.com | l 12 funds | 2016-05-23 | 2031-05-23 | 15 | GoDaddy |
| magneticflowmeter.com | magnetic flow meter | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| carolmull.com | carol mull | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| qzytele.com | qzy tele | 2011-08-15 | 2026-08-15 | 15 | Xin Net Technology Corporation |
| thesanctuaryofseminole.com | the sanctuary of seminole | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| mexican-chocolate.com | mexican chocolate | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| eyesorecreative.com | eyesore creative | 2011-08-03 | 2026-08-03 | 15 | Wild West Domains, Llc |
| rastafoamboards.com | rasta foam boards | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| leanerflow-sandbox.com | leaner flow sandbox | 2011-08-05 | 2026-08-05 | 15 | Cloudflare, Inc. |
| violinlessonshonolulu.com | violin lessons honolulu | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| thecancertreatments.com | the cancer treatments | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| quesnelcabinets.com | quesnel cabinets | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| schlageter-law.com | schlageter law | 2011-08-02 | 2026-08-02 | 15 | Enom, Llc |
| 3lifts.com | 3 lifts | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| foodscriptions.com | food scriptions | 2011-08-03 | 2026-08-03 | 15 | Bluehost Inc. |
| pluckuniversity.com | pluck university | 2011-08-04 | 2026-08-04 | 15 | Wild West Domains, Llc |
| bluecruiseyachting.com | blue cruise yachting | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| couponprovince.com | coupon province | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| alldatasheetupload.com | all data sheet upload | 2011-08-06 | 2026-08-06 | 15 | Gabia, Inc. |
| ineedabigdick.com | i need a big dick | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| parkspantry.com | parks pantry | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| hatedoneusa.com | hated one usa | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| goldbuyerdayton.com | gold buyer dayton | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| solar-fighter.com | solar fighter | 2011-08-05 | 2026-08-05 | 15 | Dinahosting S.L. |
| predatorairgunspares.com | predator air gun spares | 2011-08-02 | 2026-08-02 | 15 | Bluehost Inc. |
| elvidajero.com | el vidajero | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| lyranara.com | lyranara | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| strengtharsenal.com | strength arsenal | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| gomobileappsolutions.com | go mobile app solutions | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| rumbletuffbabies.com | rumble tuff babies | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| rumbletuffkids.com | rumble tuff kids | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| jimwestmoreland.com | jim westmoreland | 2011-08-02 | 2026-08-02 | 15 | Dreamhost, Llc |
| parkselectriccompany.com | parks electric company | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| 1myanmar.com | 1 myanmar | 2011-08-05 | 2026-08-05 | 15 | Web Commerce Communications Limited Dba Webnic.Cc |
| lacomediedesparfums.com | la comedie des parfums | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| everything20poundsandunder.com | everything 20 pounds and under | 2011-08-05 | 2026-08-05 | 15 | Eurodns S.A. |
| taiyohgarden.com | taiyoh garden | 2011-08-04 | 2026-08-04 | 15 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| heaventoearthfestival.com | heaven to earth festival | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| menopausemadesimple.com | menopause made simple | 2011-08-03 | 2026-08-03 | 15 | Enom, Llc |
| alam-maya.com | alam maya | 2011-08-08 | 2026-08-08 | 15 | Cv. Jogjacamp |
| asymmetrikltd.com | asymmetrik ltd | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| andoverstone.com | andover stone | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| boyinside.com | boy inside | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| saimuseiri-suzuki.com | saimuseiri suzuki | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| echinostextile.com | echinos textile | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| eliridgeway.com | eli ridgeway | 2011-08-03 | 2026-08-03 | 15 | Enom, Llc |
| floristrybydesign.com | floristry by design | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| ai-kdx.com | ai kdx | 2011-08-15 | 2026-08-15 | 15 | Xiamen Chinasource Internet Service Co., Ltd |
| rhapi.com | rhapi | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| kingdomgamers.com | kingdom gamers | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| ddsquote.com | dds quote | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| spiritualbooksandgifts.com | spiritual books and gifts | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| tracysundberg.com | tracy sundberg | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| safeguard-mz.com | safeguard mz | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| maryannzehaprn.com | mary ann zeha prn | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| didiadiversitycoaching.com | didia diversity coaching | 2011-08-02 | 2026-08-02 | 15 | Register.Com – Network Solutions, Llc |
| revelswitch.com | revel switch | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| ecowaterottawa.com | eco water ottawa | 2015-01-22 | 2030-01-22 | 15 | GoDaddy |
| aknoxlaw.com | a knox law | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| alphacoachingvp.com | alpha coaching vp | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| cliqlaunch.com | cliq launch | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| floridamedicalretreat.com | florida medical retreat | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| cleantechcapitalmarkets.com | clean tech capital markets | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| hyipman.com | hyip man | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| attachedfiles.com | attached files | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| fexerity.com | fexerity | 2011-09-14 | 2026-09-14 | 15 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| joni-m.com | joni m | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| aandlvending.com | a and l vending | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| delawaretickcontrol.com | delaware tick control | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| mexicototal.com | mexico total | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| america-1st.com | america 1st | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| rspnow.com | rsp now | 2012-05-30 | 2027-05-30 | 15 | GoDaddy |
| kiddieschair.com | kiddies chair | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| radyosevimli.com | radyo sevimli | 2011-08-02 | 2026-08-02 | 15 | Fbs Inc. |
| fsprosegsas.com | fsprosegsas | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| hotairhosting.com | hot air hosting | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| leahsadowski.com | leah sadowski | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| dodge-cummins.com | dodge cummins | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| tamargriggs.com | tamar griggs | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| onlinetoorder.com | online to order | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| winpaqinfo.com | winpaq info | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| daddytwinkie.com | daddy twinkie | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| gtmfieldliner.com | gtm field liner | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| rivalhost-global-dns.com | rival host global dns | 2011-08-05 | 2026-08-05 | 15 | Dynadot |
| timmyjohnston.com | timmy johnston | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| williamsoncountynewcomersclub.com | williamson county newcomers club | 2011-08-02 | 2026-08-02 | 15 | Dreamhost, Llc |
| youngfitfinancier.com | young fit financier | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| blackmailmistress.com | blackmail mistress | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| privatemortgagetraining.com | private mortgage training | 2011-08-03 | 2026-08-03 | 15 | Ionos Se |
| marlahewitt.com | marla hewitt | 2012-01-22 | 2027-01-22 | 15 | GoDaddy |
| surfclub-sal.com | surf club sal | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| droidcentre.com | droid centre | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| shutterdrop.com | shutter drop | 2011-08-01 | 2026-08-01 | 15 | Key-Systems Gmbh |
| chondrograft.com | chondro graft | 2011-08-25 | 2026-08-25 | 15 | Gransy, S.R.O. |
| strengthsourceplus.com | strength source plus | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| todo60.com | todo 60 | 2011-08-03 | 2026-08-03 | 15 | Ionos Se |
| buyaccutane20mg.com | buy accutane 20mg | 2011-08-20 | 2026-08-20 | 15 | Safenames Ltd. |
| ptfe-orings.com | ptfe o rings | 2011-11-08 | 2026-11-08 | 15 | GoDaddy |
| kybwg.com | kybwg | 2011-08-15 | 2026-08-15 | 15 | Xin Net Technology Corporation |
| thegivingmarket.com | the giving market | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| busiloan.com | busi loan | 2011-08-02 | 2026-08-02 | 15 | Enom, Llc |
| freeforumforall.com | free forum for all | 2011-08-04 | 2026-08-04 | 15 | Wild West Domains, Llc |
| ilforclosures.com | il forclosures | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| foodplantenginnering.com | food plant enginnering | 2011-11-03 | 2026-11-03 | 15 | GoDaddy |
| proformauniform.com | proforma uniform | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| musiccollectorshop.com | music collector shop | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| beachcitiesmarriage.com | beach cities marriage | 2015-09-04 | 2030-09-04 | 15 | GoDaddy |
| promythyus.com | promythyus | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| twinkdaddie.com | twink daddie | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| acyutagopi.com | acyuta gopi | 2011-08-02 | 2026-08-02 | 15 | Bluehost Inc. |
| sofabed-warehouse.com | sofa bed warehouse | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| vitaminsresearch.com | vitamins research | 2011-08-02 | 2026-08-02 | 15 | Sea Wasp, Llc |
| thesistahcafe.com | the sistah cafe | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| daddytwinky.com | daddy twinky | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| oknamos.com | oknamos | 2011-08-10 | 2026-08-10 | 15 | Regional Network Information Center, Jsc Dba Ru-Center |
| apacherald.com | apach erald | 2011-08-03 | 2026-08-03 | 15 | Network Solutions, Llc |
| mesquitebeanflour.com | mesquite bean flour | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| zeeclef.com | zee clef | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| alderonironore.com | alderon iron ore | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| indieoftheyear.com | indie of the year | 2011-08-05 | 2026-08-05 | 15 | Cloudflare, Inc. |
| appleandy.com | apple andy | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| maestro-ir.com | maestro ir | 2011-08-02 | 2026-08-02 | 15 | Bluehost Inc. |
| daddy-twinky.com | daddy twinky | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| sbcountystanddown.com | sb county stand down | 2012-08-02 | 2027-08-02 | 15 | Bluehost Inc. |
| kkdesignernails.com | kk designer nails | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| plans4addition.com | plans 4 addition | 2011-08-02 | 2026-08-02 | 15 | Enom, Llc |
| goalsettingdoesntwork.com | goal setting doesnt work | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| languageofthearts.com | language of the arts | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| onlinemusicrewards.com | online music rewards | 2011-08-05 | 2026-08-05 | 15 | Rebel Ltd |
| prosafetyrx.com | pro safety rx | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| thekingproperty.com | the king property | 2011-08-04 | 2026-08-04 | 15 | NameSilo |
| ha-takeden.com | ha takeden | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| sarahgodwinphotography.com | sarah godwin photography | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| twinky-daddy.com | twinky daddy | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| cbregolfandresort.com | cbre golf and resort | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| pcgscertifiedcoins.com | pcgs certified coins | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| chlre.com | chlre | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| taxrefundaustralia.com | tax refund australia | 2011-08-02 | 2026-08-02 | 15 | Blacknight Internet Solutions Ltd. |
| myswissinsurance.com | my swiss insurance | 2011-10-13 | 2026-10-13 | 15 | Infomaniak Network Sa |
| aweeklate.com | a week late | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| longtrousers.com | long trousers | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| c2cworldwide.com | c2c worldwide | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| daddy-twink.com | daddy twink | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| alanwilsonphotography.com | alan wilson photography | 2011-08-02 | 2026-08-02 | 15 | Register.Com – Network Solutions, Llc |
| twink-daddie.com | twink daddie | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| villapacificapts.com | villa pacifica pts | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| dyuzgul.com | dyuzgul | 2011-08-05 | 2026-08-05 | 15 | Gransy, S.R.O. |
| flowers4fundraising.com | flowers 4 fundraising | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| splendorascaldron.com | splendora scaldron | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| undeniablemusic.com | undeniable music | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| flowerxpr.com | flower xpr | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| pixy-hh.com | pixy hh | 2011-08-03 | 2026-08-03 | 15 | Enom, Llc |
| rumbletuffmom.com | rumble tuff mom | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| webdesign-lab.com | web design lab | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| top-line-group.com | top line group | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| daddy-twinkie.com | daddy twinkie | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| iancracey.com | ian cracey | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| ultratotty.com | ultra totty | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| jonkristofferson.com | jon kristofferson | 2011-08-08 | 2026-08-03 | 15 | Automattic Inc. |
| protechhomeinspectionservice.com | pro tech home inspection service | 2011-08-02 | 2026-08-02 | 15 | Register.Com – Network Solutions, Llc |
| fishcaptree.com | fish cap tree | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| sasquatchdisplayconcepts.com | sasquatch display concepts | 2013-01-15 | 2028-01-15 | 15 | GoDaddy |
| twinkdaddy.com | twink daddy | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| nissan-ajaccio.com | nissan ajaccio | 2012-05-18 | 2027-05-18 | 15 | Orange |
| creativeworklife.com | creative work life | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| foodandwineshopper.com | food and wine shopper | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| lolikka.com | lolikka | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| sofabeds4hotels.com | sofa beds 4 hotels | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| chicagofamilybusinesscenter.com | chicago family business center | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| marcfoiles.com | marc foiles | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| lffac.com | lffac | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| yourpokergames.com | your poker games | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| shuzikong.com | shu zi kong | 2011-08-06 | 2026-08-06 | 15 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| sinhcafehanoi.com | sinh cafe hanoi | 2011-08-05 | 2026-08-05 | 15 | Nhan Hoa Software Company Ltd. |
| emilysundberg.com | emily sundberg | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| mifarmaonline.com | mi farma online | 2011-08-05 | 2026-08-05 | 15 | Dinahosting S.L. |
| modernsilvereagles.com | modern silver eagles | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| laragalkhatib.com | lara gal khatib | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| hy-sdxt.com | hy sdxt | 2011-08-11 | 2026-08-11 | 15 | Jiangsu Bangning Science & Technology Co. Ltd. |
| chasingthedreamre.com | chasing the dream re | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| rumbletuffkid.com | rumble tuff kid | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| wildfireonthemountain.com | wildfire on the mountain | 2011-09-13 | 2026-09-13 | 15 | GoDaddy |
| igapotsdam.com | iga potsdam | 2011-08-01 | 2026-08-01 | 15 | Sav.Com, Llc |
| hipwebinar.com | hip webinar | 2011-08-02 | 2026-08-02 | 15 | Bluehost Inc. |
| astro-bling.com | astro bling | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| dietperfection.com | diet perfection | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| amherstpharmacy.com | amherst pharmacy | 2011-09-06 | 2026-09-06 | 15 | Amazon Registrar, Inc. |
| wittockkitchenandbathtraversecity.com | wittock kitchen and bath traverse city | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| esozoku.com | e sozoku | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| helpforhairremoval.com | help for hair removal | 2011-08-05 | 2026-08-05 | 15 | Namespro Solutions Inc. |
| nataliababarovic.com | natalia babarovic | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| ngccertifiedcoins.com | ngc certified coins | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| hpbauer.com | hp bauer | 2011-09-13 | 2026-09-13 | 15 | Ionos Se |
| tamilula.com | tamil ula | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| rct3csos.com | rct3 csos | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| arrullio.com | arrullio | 2011-08-03 | 2026-08-03 | 15 | Europlanet G.P. |
| xuanfumen.com | xuan fu men | 2011-08-15 | 2026-08-15 | 15 | Xin Net Technology Corporation |
| eapotheek.com | e apotheek | 2011-08-01 | 2026-08-01 | 15 | Key-Systems Gmbh |
| twink-daddy.com | twink daddy | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| mazehaprn.com | mazeha prn | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| opoimo.com | opoimo | 2011-08-12 | 2026-08-12 | 15 | Bizcn.Com, Inc. |
| mamakaza.com | mama kaza | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| woodpeckerjoineryshop.com | woodpecker joinery shop | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| abartozin.com | abartozin | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| sunandsurfcolony.com | sun and surf colony | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| xiandaohong.com | xian dao hong | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| rhiannacarter.com | rhianna carter | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| sofabedsforhotels.com | sofa beds for hotels | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| drewrock.com | drew rock | 2011-09-01 | 2026-09-01 | 15 | Registrygate Gmbh |
| meirongyiqi8.com | mei rong yi qi 8 | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| cosbyhollowcabin.com | cosby hollow cabin | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| capmem.com | cap mem | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| freeforumsforall.com | free forums for all | 2011-08-04 | 2026-08-04 | 15 | Wild West Domains, Llc |
| anxietyovercome.com | anxiety overcome | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| bebalancedbybiancabernhardt.com | be balanced by bianca bernhardt | 2011-09-13 | 2026-09-13 | 15 | Ionos Se |
| ustoymagic.com | us toy magic | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| colorworkspro.com | color works pro | 2011-08-02 | 2026-08-02 | 15 | Launchpad.Com Inc. |
| etiee.com | etiee | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| barmandec.com | barman dec | 2011-08-02 | 2026-08-02 | 15 | 1Api Gmbh |
| bosc-izarn.com | bosc izarn | 2012-02-29 | 2027-02-28 | 15 | Orange |
| wowfactorywines.com | wow factory wines | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| 2njoy-it.com | 2njoy it | 2011-08-03 | 2026-08-03 | 15 | Orange |
| chatterindia.com | chatter india | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| ampleresults.com | ample results | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| roosterroost.com | rooster roost | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| legalsilencer.com | legal silencer | 2011-08-02 | 2026-08-02 | 15 | Dreamhost, Llc |
| marketfiend.com | market fiend | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| twinkie-daddy.com | twinkie daddy | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| reflexionsllc.com | reflexions llc | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| marypiatt.com | mary piatt | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| myproductprograms.com | my product programs | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| hotel-sofa.com | hotel sofa | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| diariodelooks.com | diario de looks | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| bookofprovidence.com | book of providence | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| coolschoolfundraiser.com | cool school fundraiser | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| ranchoortega.com | rancho ortega | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| legaldiamond.com | legal diamond | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| disasterbookstore.com | disaster bookstore | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| perryrcfliers.com | perry rc fliers | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| stonecreationsga.com | stone creations ga | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| ukfutons.com | uk futons | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| pcgssilvereagles.com | pcgs silver eagles | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| kingsautonj.com | kings auto nj | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| denverdingdent.com | denver ding dent | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| chatrina.com | chatrina | 2011-08-03 | 2026-08-03 | 15 | Bigrock Solutions Ltd. |
| 26xz.com | 26 xz | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| paduse.com | paduse | 2011-08-06 | 2026-08-06 | 15 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| domepiz.com | dome piz | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| rosemarymuldoon.com | rosemary muldoon | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| daxcastellon.com | dax castellon | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| akweber.com | ak weber | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| pcpet-global.com | pc pet global | 2011-08-11 | 2026-08-11 | 15 | Regional Network Information Center, Jsc Dba Ru-Center |
| fashionfundas.com | fashion fundas | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| facefrontphotography.com | face front photography | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| kiteperformance.com | kite performance | 2011-08-05 | 2026-08-05 | 15 | NameSilo |
| theproofagency.com | the proof agency | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| ezbucks4gold.com | ez bucks 4 gold | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| moderncomforttx.com | modern comfort tx | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| netzwerk-implantologie.com | netzwerk implantologie | 2011-08-01 | 2026-08-01 | 15 | Mesh Digital Limited |
| credibilityacademy.com | credibility academy | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| sjctdc.com | sjctdc | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| footloosetreks.com | footloose treks | 2011-08-03 | 2026-08-03 | 15 | Wild West Domains, Llc |
| nosleeptillkessel.com | no sleep till kessel | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| kidzembassy.com | kidz embassy | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| ddjygl.com | ddjygl | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| autoridaddivina.com | autoridad divina | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| kickthefruit.com | kick the fruit | 2011-08-03 | 2026-08-03 | 15 | Ionos Se |
| hrcommunicationexperts.com | hr communication experts | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| golistenboise.com | go listen boise | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| homemortgagesutah.com | home mortgages utah | 2011-08-02 | 2026-08-02 | 15 | Bluehost Inc. |
| iplayolg.com | i play olg | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| derekhauser.com | derek hauser | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| lifetransformingtreasurespodcast.com | life transforming treasures podcast | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| wcpdbahamas.com | wcpd bahamas | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| atelierpapillon.com | atelier papillon | 2011-11-05 | 2026-11-05 | 15 | GoDaddy |
| gravitametals.com | gravita metals | 2011-08-03 | 2026-08-03 | 15 | Liquidnet Ltd. |
| lvgfit.com | lvg fit | 2014-11-04 | 2029-11-04 | 15 | GoDaddy |
| kanglongtiyu.com | kang long ti yu | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| cycling-monton.com | cycling monton | 2011-08-21 | 2026-08-21 | 15 | Safenames Ltd. |
| franklincountylocksmith.com | franklin county locksmith | 2011-08-03 | 2026-08-03 | 15 | Wild West Domains, Llc |
| twinkiedaddy.com | twinkie daddy | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| solarfighters.com | solar fighters | 2011-08-05 | 2026-08-05 | 15 | Dinahosting S.L. |
| ballandbmw.com | ball and bmw | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| zztonsgan.com | zztonsgan | 2011-08-05 | 2026-08-05 | 15 | NameSilo |
| iwantthattoynow.com | i want that toy now | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| farmfreshmaui.com | farm fresh maui | 2011-03-01 | 2026-08-03 | 15 | GoDaddy |
| cumbiayreggaeton.com | cumbia y reggaeton | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| jonisellslasvegas.com | joni sells las vegas | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| forumsfreeforall.com | forums free for all | 2011-08-04 | 2026-08-04 | 15 | Wild West Domains, Llc |
| zhongxunhr.com | zhong xun hr | 2011-08-12 | 2026-08-12 | 15 | Bizcn.Com, Inc. |
| fuel-party.com | fuel party | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| lucasgroupscam.com | lucas group scam | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| bhwr2.com | bhwr 2 | 2011-08-02 | 2026-08-02 | 15 | Bluehost Inc. |
| ugpnebraskaapparel.com | ugp nebraska apparel | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| brodproductions.com | brod productions | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| d1led.com | d 1 led | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| nicolegehring.com | nicole gehring | 2011-09-15 | 2026-09-15 | 15 | Registrygate Gmbh |
| spiritualgiftsandbooks.com | spiritual gifts and books | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| roeschchryslerjeepdodge.com | roesch chrysler jeep dodge | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| spilledmilkshakedesigns.com | spilled milkshake designs | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| bjjyfs.com | bjjyfs | 2011-08-01 | 2026-08-01 | 15 | Chengdu West Dimension Digital Technology Co., Ltd. |
| istanbultiyatrolari.com | istanbul tiyatrolari | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| thesurgeries.com | the surgeries | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| daddytwink.com | daddy twink | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| easymobilerechage.com | easymobilerechage | 2011-08-03 | 2026-08-03 | 15 | Blue Razor Domains, Llc |
| triconsoft.com | tricon soft | 2011-08-04 | 2026-08-04 | 15 | Dynadot |
| fullofgoodideas.com | full of good ideas | 2011-08-03 | 2026-08-03 | 15 | Ionos Se |
| 1800bigdick.com | 1800 big dick | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| myemploymentlawadvisor.com | my employment law advisor | 2011-08-02 | 2026-08-02 | 15 | Register.Com – Network Solutions, Llc |
| electroniccigarettesmanufacturing.com | electronic cigarettes manufacturing | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| univers-senior.com | univers senior | 2011-08-03 | 2026-08-03 | 15 | Ionos Se |
| ontariogoldexchange.com | ontario gold exchange | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| goelectroniccigarette.com | go electronic cigarette | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| resopath.com | reso path | 2012-04-03 | 2027-04-03 | 15 | Orange |
| rifemd.com | rife md | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| angeliquehall.com | angelique hall | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| titantrainers.com | titan trainers | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| gorechargeit.com | go recharge it | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| pcgsgoldeagles.com | pcgs gold eagles | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| thehomebuilding.com | the home building | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| mgamerzproductions.com | mgamerz productions | 2011-08-05 | 2026-08-05 | 15 | Dynadot |
| markwryandesign.com | mark wryan design | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| pechakuchasheffield.com | pecha kucha sheffield | 2011-08-03 | 2026-08-03 | 15 | Ionos Se |
| programtasselsplus.com | program tassels plus | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| magnesiumsupreme.com | magnesium supreme | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| yiwusz.com | yi wu sz | 2011-08-15 | 2026-08-15 | 15 | Xiamen Chinasource Internet Service Co., Ltd |
| aimeemee.com | aimee mee | 2011-08-02 | 2026-08-02 | 15 | Dreamhost, Llc |
| derekbhauserdentist.com | derek b hauser dentist | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| buy-sellsandiegohomes.com | buy sell san diego homes | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| ganggumarina.com | ganggu marina | 2011-08-06 | 2026-08-06 | 15 | Gabia, Inc. |
| xiaofangpao.com | xiao fang pao | 2011-08-14 | 2026-08-14 | 15 | Gname.Com Pte. Ltd. |
| keevahairartistry.com | keeva hair artistry | 2011-08-03 | 2026-08-03 | 15 | Wild West Domains, Llc |
| challengetheself.com | challenge the self | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| synepd.com | synepd | 2012-12-21 | 2027-12-21 | 15 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| up2coderetrofitter.com | up 2 code retrofitter | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| donglitou.com | dong li tou | 2011-08-15 | 2026-08-15 | 15 | Xin Net Technology Corporation |
| nvphotoboise.com | nv photo boise | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| happiness-exchange.com | happiness exchange | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| notaprettygirl.com | not a pretty girl | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| vahlecreative.com | vahle creative | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| linagaz.com | lina gaz | 2011-08-03 | 2026-08-03 | 15 | Realtime Register B.V. |
| aseviaco.com | aseviaco | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| b-mein.com | b mein | 2011-10-01 | 2026-10-01 | 15 | Mesh Digital Limited |
| bukitpurmei.com | bukit pur mei | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| syxaxf.com | syxaxf | 2011-08-05 | 2026-08-05 | 15 | NameSilo |
| lotuo.com | lotuo | 2011-07-31 | 2026-07-31 | 15 | Chengdu West Dimension Digital Technology Co., Ltd. |
| florian-pluer.com | florian pluer | 2011-08-03 | 2026-08-03 | 15 | Ionos Se |
| m-mroofing.com | m m roofing | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| dratodaria.com | dr atodaria | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| arabi-press.com | arabi press | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| xnswzx.com | xnswzx | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| ineedbigdick.com | i need big dick | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| bookmarktasselplus.com | bookmark tassel plus | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| personalityparenting.com | personality parenting | 2011-08-02 | 2026-08-02 | 15 | Launchpad.Com Inc. |
| quiltingbyholly.com | quilting by holly | 2011-08-02 | 2026-08-02 | 15 | Domain.Com – Network Solutions, Llc |
| myspooner.com | my spooner | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| ngcsilvereagles.com | ngc silver eagles | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| 0919hi.com | 0919 hi | 2011-08-14 | 2026-08-14 | 15 | Gname.Com Pte. Ltd. |
| rebyoo.com | rebyoo | 2011-08-03 | 2026-08-03 | 15 | Network Solutions, Llc |
| any-maker.com | any maker | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| stewartporter.com | stewart porter | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| cityhousesupplyco.com | city house supply co | 2011-08-02 | 2026-08-02 | 15 | Dreamhost, Llc |
| ultrassd.com | ultra ssd | 2011-08-06 | 2026-08-06 | 15 | Gabia, Inc. |
| derekbhauser.com | derek b hauser | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| lazeezaffair.com | lazeez affair | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| praiseworthyidea.com | praiseworthy idea | 2011-08-05 | 2026-08-05 | 15 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| cruiseandchill.com | cruise and chill | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| myveinclinic.com | my vein clinic | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| todo50.com | todo 50 | 2011-08-03 | 2026-08-03 | 15 | Ionos Se |
| clickmisfacturas.com | click mis facturas | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| crazyfrogonline.com | crazy frog online | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| anudalva.com | anudalva | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| osadbslf.com | osadbslf | 2011-08-03 | 2026-08-03 | 15 | Network Solutions, Llc |
| coyne-sc.com | coyne sc | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| bdrobinson.com | bd robinson | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| fifthchannelnetwork.com | fifth channel network | 2011-08-03 | 2026-08-03 | 15 | Network Solutions, Llc |
| qnczkj.com | qnczkj | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| programtasselplus.com | program tassel plus | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| katesundberg.com | kate sundberg | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| ecowaterkemptville.com | eco water kemptville | 2015-01-22 | 2030-01-22 | 15 | GoDaddy |
| nomorefloaters.com | no more floaters | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| gruasamerican.com | gruas american | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| shreetorana.com | shree torana | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| catfiz.com | catfiz | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| shakeyspizzafranchise.com | shakeys pizza franchise | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| e5executivecoaching.com | e 5 executive coaching | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| portperrymedicalsupplies.com | port perry medical supplies | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| collegeprepconsultant.com | college prep consultant | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| derekbhauserdds.com | derek b hauser dds | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| wendyfrank.com | wendy frank | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| jonessmile.com | jones smile | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| leadingwithpresence.com | leading with presence | 2011-08-04 | 2026-08-04 | 15 | Easydns Technologies Inc. |
| capilano-shoes.com | capilano shoes | 2011-08-09 | 2026-08-09 | 15 | Regional Network Information Center, Jsc Dba Ru-Center |
| alexandrawoolcott.com | alexandra woolcott | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| hljkongjie.com | hlj kong jie | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| offlineonlineconsultancy.com | offline online consultancy | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| bestmopolitan.com | best mopolitan | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| concreteimagination.com | concrete imagination | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| nu-delhilounge.com | nu delhi lounge | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| andrewthiessen.com | andrew thiessen | 2011-08-02 | 2026-08-02 | 15 | Register.Com – Network Solutions, Llc |
| justwannalift.com | just wanna lift | 2011-08-04 | 2026-08-04 | 15 | Wild West Domains, Llc |
| ayerrajah.com | ayer rajah | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| restoredtostand.com | restored to stand | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| electroniccigaretteswholesaler.com | electronic cigarettes wholesaler | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| sedees.com | sedees | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| corbinlawsc.com | corbin law sc | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| legalsilencers.com | legal silencers | 2011-08-02 | 2026-08-02 | 15 | Dreamhost, Llc |
| singletrailmap.com | single trail map | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| ccpseo.com | ccp seo | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| bluevortexgames.com | blue vortex games | 2011-08-03 | 2026-08-03 | 15 | Bluehost Inc. |
| girlsprepbronx.com | girls prep bronx | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| 4njoy-it.com | 4njoy it | 2011-08-03 | 2026-08-03 | 15 | Orange |
| lavieenmouvement.com | la vie en mouvement | 2011-08-02 | 2026-08-02 | 15 | 1Api Gmbh |
| corehealingllc.com | core healing llc | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| sonomaviewestate.com | sonoma view estate | 2011-08-02 | 2026-08-02 | 15 | Enom, Llc |
| relationalcouplescounseling.com | relational couples counseling | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| tsfangdao.com | ts fang dao | 2011-08-14 | 2026-08-14 | 15 | Gname.Com Pte. Ltd. |
| hoyledental.com | hoyle dental | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| iwallfinder.com | i wall finder | 2011-08-05 | 2026-08-05 | 15 | Dynadot |
| radinmas.com | radin mas | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| bookmarktasselsplus.com | bookmark tassels plus | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| modoftheyear.com | mod of the year | 2011-08-05 | 2026-08-05 | 15 | Cloudflare, Inc. |
| sweettoeatgifts.com | sweet to eat gifts | 2011-09-01 | 2026-08-03 | 15 | GoDaddy |
| countryhousesupplyco.com | country house supply co | 2011-08-02 | 2026-08-02 | 15 | Dreamhost, Llc |
| comerdesign.com | comer design | 2011-09-13 | 2026-09-13 | 15 | GoDaddy |
| ourdavidteacher.com | our david teacher | 2011-08-02 | 2026-08-02 | 15 | Launchpad.Com Inc. |
| halkhersan.com | halk hersan | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| egrsm-dz.com | egrsm dz | 2011-08-04 | 2026-08-04 | 15 | NameSilo |
| infocusthefilm.com | in focus the film | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| rcustomhomes.com | r custom homes | 2011-08-03 | 2026-08-03 | 15 | Wild West Domains, Llc |
| socomal.com | socomal | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| yourdependendentverification.com | yourdependendentverification | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| fuenteobejunabiblioteca.com | fuente obejuna biblioteca | 2011-08-02 | 2026-08-02 | 15 | Ionos Se |
| coolactress.com | cool actress | 2011-08-04 | 2026-08-04 | 15 | Dynadot |
| thereikibox.com | the reiki box | 2011-08-05 | 2026-08-05 | 15 | Tecnocrática Centro De Datos, S.L. |
| xratedcontent.com | x rated content | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| innerpeacepastor.com | inner peace pastor | 2011-08-03 | 2026-08-03 | 15 | Register.Com – Network Solutions, Llc |
| ngcgoldeagles.com | ngc gold eagles | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| xxentria-solar.com | xxentria solar | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| sasquatchdc.com | sasquatch dc | 2013-01-15 | 2028-01-15 | 15 | GoDaddy |
| sclbrasil.com | scl brasil | 2011-08-03 | 2026-08-03 | 15 | Enom, Llc |
| passwordsicura.com | password sicura | 2011-08-03 | 2026-08-03 | 15 | Soluciones Corporativas Ip, Sl |
| haroldhammett.com | harold hammett | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| ferrerrogersdesign.com | ferrer rogers design | 2011-08-03 | 2026-08-03 | 15 | Dreamhost, Llc |
| sallyskitchentable.com | sallys kitchen table | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| wrtsource.com | wrt source | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| keywordsupplier.com | keyword supplier | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| surelogicllc.com | sure logic llc | 2012-01-11 | 2027-01-11 | 15 | GoDaddy |
| aztaylormadeglassllc.com | az taylor made glass llc | 2011-09-13 | 2026-09-13 | 15 | GoDaddy |
| cowboyupforchrist.com | cowboy up for christ | 2011-08-02 | 2026-08-02 | 15 | Bluehost Inc. |
| johnemmettobrien.com | john emmett obrien | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| jhwesq.com | jhw esq | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| modernsilvercoins.com | modern silver coins | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| electroniccigarettewholesalers.com | electronic cigarette wholesalers | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| mssundberg.com | ms sundberg | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| shannondupuis.com | shannon dupuis | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| derekhauserdds.com | derek hauser dds | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| artgolfclassics.com | art golf classics | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| ianracey.com | ian racey | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| hideoutpubandgrill.com | hideout pub and grill | 2011-08-03 | 2026-08-03 | 15 | Wild West Domains, Llc |
| stylesuwant.com | styles u want | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| elekleader.com | elek leader | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| indiainvestmentadvisors.com | india investment advisors | 2011-08-03 | 2026-08-03 | 15 | Enom, Llc |
| hotel-sofas.com | hotel sofas | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| advancechex.com | advance chex | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| twinkydaddy.com | twinky daddy | 2011-08-22 | 2026-08-22 | 15 | Safenames Ltd. |
| just4kidzeducation.com | just 4 kidz education | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| lcbeverages.com | lc beverages | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| mailfwvn.com | mail fwvn | 2011-08-02 | 2026-08-02 | 15 | Network Solutions, Llc |
| ritchiaccessoires.com | ritchi accessoires | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| omegarip.com | omega rip | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| kremerdesigngroup.com | kremer design group | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| farandsureartgolfclassics.com | far and sure art golf classics | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| dgsinger.com | dg singer | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| untidywhities.com | untidy whities | 2011-11-05 | 2026-11-05 | 15 | GoDaddy |
| ysimda.com | ysimda | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| dsp-solutions.com | dsp solutions | 2011-08-05 | 2026-08-05 | 15 | Eurodns S.A. |
| dealsitesreviews.com | deal sites reviews | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| mishe-events.com | mishe events | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| hrbsizu.com | hrbsizu | 2011-08-13 | 2026-08-13 | 15 | Gname.Com Pte. Ltd. |
| driedbranches.com | dried branches | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| rvautocorral.com | rv auto corral | 2011-08-03 | 2026-08-03 | 15 | Bluehost Inc. |
| clairewicker.com | claire wicker | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| annieandforrest.com | annie and forrest | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| websitesxtreme.com | websites xtreme | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| movingwithlenovo.com | moving with lenovo | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| sizzlinsummerevent.com | sizzlin summer event | 2011-08-03 | 2026-08-03 | 15 | Wild West Domains, Llc |
| darrishurst.com | darris hurst | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| cascoplay.com | casco play | 2011-11-04 | 2026-11-04 | 15 | GoDaddy |
| thecarcleaning.com | the car cleaning | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| scottangove.com | scott angove | 2011-08-03 | 2026-08-03 | 15 | Automattic Inc. |
| chrisvnm.com | chris vnm | 2011-08-02 | 2026-08-02 | 15 | Register.Com – Network Solutions, Llc |
| entactenv.com | entact env | 2011-09-13 | 2026-09-13 | 15 | GoDaddy |
| greeksforgood.com | greeks for good | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| shop4wheels.com | shop 4 wheels | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| wordswithfriendsfacebook.com | words with friends facebook | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| at-berry.com | at berry | 2011-08-02 | 2026-08-02 | 15 | Key-Systems Gmbh |
| groovephonics.com | groove phonics | 2011-08-05 | 2026-08-05 | 15 | NameSilo |
| americujobs.com | americu jobs | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| silver-towne.com | silver towne | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| kaiyayasumi.com | kaiya yasumi | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| i-mee.com | i mee | 2011-08-04 | 2026-08-04 | 15 | GoDaddy |
| fasterthanaturtle.com | faster than a turtle | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| dbwilliamsproperties.com | db williams properties | 2012-08-03 | 2027-08-04 | 15 | GoDaddy |
| flightstockings.com | flight stockings | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| valeriamendez.com | valeria mendez | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| ebtintelligence.com | ebt intelligence | 2011-08-16 | 2026-08-16 | 15 | Guangdong Jinwanbang Technology Investment Co., Ltd. |
| krngbl.com | krngbl | 2011-08-04 | 2026-08-04 | 15 | NameSilo |
| marylandfootdoctor.com | maryland foot doctor | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| woodpeckerjoineryonlineshop.com | woodpecker joinery online shop | 2011-08-03 | 2026-08-03 | 15 | 123-Reg Limited |
| aluminiumfs.com | aluminium fs | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| mossbergmvp.com | mossberg mvp | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| galjak-law-office.com | galjak law office | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| ssolved.com | ssolved | 2011-08-05 | 2026-08-05 | 15 | NameSilo |
| patsfabulousfinds.com | pats fabulous finds | 2011-08-02 | 2026-08-02 | 15 | Bluehost Inc. |
| amebloscr.com | ameblo scr | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| dasterkhawan.com | daster khawan | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| monolithicdesign.com | monolithic design | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| lucasgroupscams.com | lucas group scams | 2011-08-04 | 2026-08-04 | 15 | Tucows Domains Inc. |
| batukefestival.com | batuke festival | 2011-08-02 | 2026-08-02 | 15 | Register.Com – Network Solutions, Llc |
| alexander-papadopulos.com | alexander papadopulos | 2011-12-05 | 2026-12-05 | 15 | Mesh Digital Limited |
| igidel1a1.com | igidel1a1 | 2011-08-18 | 2026-08-18 | 15 | Ionos Se |
| apacdiplomat.com | apac diplomat | 2011-08-03 | 2026-08-03 | 15 | Network Solutions, Llc |
| kingsautoshownj.com | kings auto show nj | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| coomulasedco.com | coomulasedco | 2011-08-03 | 2026-08-03 | 15 | GoDaddy |
| alifcosaudi.com | alifco saudi | 2011-08-03 | 2026-08-03 | 15 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| barskins.com | bar skins | 2011-08-04 | 2026-08-04 | 15 | Turncommerce, Inc. Dba Namebright.Com |
| digital-inceptions.com | digital inceptions | 2011-08-03 | 2026-08-03 | 15 | Namecheap |
| penguinmouse.com | penguin mouse | 2011-08-04 | 2026-08-04 | 15 | Easydns Technologies Inc. |
| tobyarnoldassociates.com | toby arnold associates | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| odorcatch.com | odor catch | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| baodaovision.com | bao dao vision | 2012-08-15 | 2026-08-15 | 14 | Xiamen Chinasource Internet Service Co., Ltd |
| mujerconalas.com | mujer con alas | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| zzsqsx.com | zzsqsx | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| apaganodesigns.com | apagano designs | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| qubodizajn.com | qubo dizajn | 2012-08-03 | 2026-08-03 | 14 | Go Montenegro Domains, Llc |
| jabonplus.com | jabon plus | 2012-08-28 | 2026-08-28 | 14 | Dattatec Corp |
| imantichickfila.com | imanti chick fil a | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| binspiredapparel.com | b inspired apparel | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| zouluan.com | zou luan | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| bootsvermietung-calabona.com | boots vermietung calabona | 2012-12-20 | 2026-12-20 | 14 | Registrygate Gmbh |
| appraiserminneapolis.com | appraiser minneapolis | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| pleaseshootme.com | please shoot me | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| shequ66.com | she qu 66 | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| parasolarts.com | parasol arts | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| clinicalhealthcoachtraining.com | clinical health coach training | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| 365eche.com | 365 eche | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| krimi-kollegen.com | krimi kollegen | 2012-11-16 | 2026-11-16 | 14 | Hetzner Online Gmbh |
| ywwoke.com | ywwoke | 2012-08-06 | 2026-08-06 | 14 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| morgantondrug.com | morganton drug | 2012-08-21 | 2026-08-21 | 14 | Amazon Registrar, Inc. |
| yingbo4x4.com | ying bo 4×4 | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| xtreme-edge.com | xtreme edge | 2012-08-02 | 2026-08-02 | 14 | Enom, Llc |
| far-koeln.com | far koeln | 2013-08-15 | 2027-08-15 | 14 | Http.Net Internet Gmbh |
| microunitsnyc.com | micro units nyc | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| brahmincomeunity.com | brahmin come unity | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| 215realestate.com | 215 real estate | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| jiujitsuvietnam.com | jiujitsu vietnam | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| tvagentblog.com | tv agent blog | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| yogawithkristinetom.com | yoga with kristine tom | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| halpaaon.com | halpaa on | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| szshengzhong.com | sz sheng zhong | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| islamisch.com | islamisch | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| pcidatafinder.com | pci data finder | 2013-03-25 | 2027-05-14 | 14 | GoDaddy |
| casalcar.com | casal car | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| universoalterno.com | universo alterno | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| masonrymavens.com | masonry mavens | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| prochickfila.com | pro chick fil a | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| fancydressingup.com | fancy dressing up | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| china-eurofins.com | china eurofins | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| thinktankblog.com | think tank blog | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| bagscam.com | bags cam | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| applepiebooks.com | apple pie books | 2012-08-02 | 2026-08-02 | 14 | Bluehost Inc. |
| apyoutuo.com | ap you tuo | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| npidesign.com | npi design | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| imicroservices.com | i microservices | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| stogiefriends.com | stogie friends | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| ruotiao.com | ruo tiao | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| servicestreettraining.com | service street training | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| sinoma-mica.com | sinoma mica | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| yougiftcard.com | you gift card | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| bbxzce.com | bbxzce | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| hurtseedco.com | hurt seed co | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| parkairtravelinc.com | park air travel inc | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| locksmithfridley.com | locksmith fridley | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| vistacruisers.com | vista cruisers | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| mtvernondentistry.com | mt vernon dentistry | 2012-12-12 | 2026-12-12 | 14 | GoDaddy |
| bigmantim.com | big man tim | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| grubrover.com | grub rover | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| linkedhealthanswers.com | linked health answers | 2012-08-01 | 2026-08-01 | 14 | Mesh Digital Limited |
| olympiccloud.com | olympic cloud | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| livinginarchitecture.com | living in architecture | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| leannebutler.com | leanne butler | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| societygolfing.com | society golfing | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| travellerviews.com | traveller views | 2012-08-03 | 2026-08-03 | 14 | Wild West Domains, Llc |
| tshirtscool.com | tshirts cool | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| connect2ventures.com | connect 2 ventures | 2013-08-16 | 2027-08-16 | 14 | Mesh Digital Limited |
| antigayflag.com | anti gay flag | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| jordanrealtymn.com | jordan realty mn | 2012-10-17 | 2026-08-03 | 14 | GoDaddy |
| allureinvitations.com | allure invitations | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| metrocrisis.com | metro crisis | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| blackpearlsandleather.com | black pearls and leather | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| saintswin.com | saints win | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| crystalduggan.com | crystal duggan | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| tiaoniang.com | tiao niang | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| northerndating.com | northern dating | 2012-08-05 | 2026-08-05 | 14 | Cloudflare, Inc. |
| krimikollegen.com | krimi kollegen | 2012-11-16 | 2026-11-16 | 14 | Hetzner Online Gmbh |
| learningaboutart.com | learning about art | 2013-04-03 | 2027-04-03 | 14 | GoDaddy |
| braklowcustomhomes.com | braklow custom homes | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| bigcatsailingcharters.com | big cat sailing charters | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| neripazreyes.com | neri paz reyes | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| proshopdesigns.com | pro shop designs | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| itedx.com | itedx | 2012-08-05 | 2026-08-05 | 14 | Dynadot |
| bootsvermietung-portocristo.com | boots vermietung porto cristo | 2012-12-20 | 2026-12-20 | 14 | Registrygate Gmbh |
| prettycreep.com | pretty creep | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| foodiephotog.com | foodie photog | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| zongrao.com | zong rao | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| haoyumuye.com | hao yu mu ye | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| nc-punch.com | nc punch | 2012-08-01 | 2026-08-01 | 14 | Chengdu West Dimension Digital Technology Co., Ltd. |
| decproject.com | dec project | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| rushmorehosting.com | rushmore hosting | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| tax411.com | tax 411 | 2012-08-03 | 2026-08-03 | 14 | Bigrock Solutions Ltd. |
| routespotter.com | route spotter | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| pdrti.com | pdrti | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| emigroups.com | emi groups | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| locksmithchaska.com | locksmith chaska | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| bootlacelicencing.com | bootlace licencing | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| progays.com | pro gays | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| hontinhk.com | hon tin hk | 2012-08-03 | 2026-08-03 | 14 | Enom, Llc |
| tahitianandfreshwaterpearls.com | tahitian and freshwater pearls | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| imprezzing.com | imprezzing | 2012-11-04 | 2026-11-04 | 14 | GoDaddy |
| mylakecabin.com | my lake cabin | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| villeneuvehangars.com | villeneuve hangars | 2012-12-13 | 2026-12-13 | 14 | GoDaddy |
| 029hengrui.com | 029 heng rui | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| smggy.com | smggy | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| karatekyokushinkai.com | karate kyokushinkai | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| sat4boys.com | sat 4 boys | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| wunderr.com | wunderr | 2012-08-02 | 2026-08-02 | 14 | Domain.Com – Network Solutions, Llc |
| magentodotnetlicencing.com | magento dot net licencing | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| improchickfila.com | impro chick fil a | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| drurbina.com | dr urbina | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| szbbynk.com | szbbynk | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| gansang.com | gan sang | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| storyofanasiapractice.com | story of an asia practice | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| mnemotechnik.com | mnemotechnik | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| hyper-sphere.com | hyper sphere | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| lesshoused.com | less housed | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| taishanlonggu.com | tai shan long gu | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| bladpq.com | bladpq | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| chargespotter.com | charge spotter | 2012-11-04 | 2026-11-04 | 14 | GoDaddy |
| u-flooria.com | u flooria | 2013-01-02 | 2027-01-02 | 14 | GoDaddy |
| wm-commonsatwhitemarsh.com | wm commons at white marsh | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| dc1989.com | dc 1989 | 2012-08-07 | 2026-08-07 | 14 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| magicalmemorymaker.com | magical memory maker | 2012-08-03 | 2026-08-03 | 14 | Enom, Llc |
| northumberlandtalkingtherapies.com | northumberland talking therapies | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| learning-anywhere.com | learning anywhere | 2012-08-02 | 2026-08-02 | 14 | Key-Systems Gmbh |
| printtwopoint0.com | print two point 0 | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| dotnetlicencing.com | dot net licencing | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| mpsondemand.com | mps on demand | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| purlmaestro.com | purl maestro | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| bizztraveler.com | bizz traveler | 2012-12-24 | 2026-12-24 | 14 | GoDaddy |
| oliversom.com | oliversom | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| gan-bei.com | gan bei | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| hck9.com | hck 9 | 2012-08-02 | 2026-08-02 | 14 | Network Solutions, Llc |
| bjmicrotech.com | bj micro tech | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| atlqualitydentalcare.com | atl quality dental care | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| shikela.com | shikela | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| citytechapac.com | city tech apac | 2012-08-02 | 2026-08-02 | 14 | Network Solutions, Llc |
| baycoastautosales.com | bay coast auto sales | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| bjyibd.com | bj yibd | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| ear-brain-fitness.com | ear brain fitness | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| heizoelboerse.com | heizoel boerse | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| drjcope.com | dr j cope | 2012-08-02 | 2026-08-02 | 14 | Register.Com – Network Solutions, Llc |
| bootsvermietung-calamillor.com | boots vermietung cala millor | 2012-12-20 | 2026-12-20 | 14 | Registrygate Gmbh |
| radiationaudit.com | radiation audit | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| xn--fiqs8s6c894rb0h.com | xn--fiqs8s6c894rb0h | 2012-08-06 | 2026-08-06 | 14 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| renemargo.com | rene margo | 2012-08-02 | 2026-08-02 | 14 | Bluehost Inc. |
| jtec24.com | jtec 24 | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| qxdisplays.com | qx displays | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| grasaultra.com | grasau ltra | 2012-08-28 | 2026-08-28 | 14 | Dattatec Corp |
| teamollc.com | team o llc | 2012-08-02 | 2026-08-02 | 14 | Enom, Llc |
| naplesbestplasticsurgeon.com | naples best plastic surgeon | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| pureplasmalift.com | pure plasma lift | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| construction-law-attorney.com | construction law attorney | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| drjanscott.com | dr jan scott | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| makeupbyashleymooney.com | makeup by ashley mooney | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| dependable-delivery.com | dependable delivery | 2012-11-04 | 2026-11-04 | 14 | GoDaddy |
| ld2009.com | ld 2009 | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| hmcsystems.com | hmc systems | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| firstchoicehealthyvending.com | first choice healthy vending | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| tdabeautysupply.com | tda beauty supply | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| pickyourpassage.com | pick your passage | 2012-08-02 | 2026-08-02 | 14 | Bluehost Inc. |
| 80xkx.com | 80 xkx | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| wimbornestoves.com | wimborne stoves | 2012-08-03 | 2026-08-03 | 14 | 123-Reg Limited |
| becodehappy.com | be code happy | 2012-08-03 | 2026-08-03 | 14 | Dnc Holdings, Inc. |
| buywiththehomeguyz.com | buy with the home guyz | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| handboekoven.com | handboek oven | 2012-09-15 | 2026-09-15 | 14 | Metaregistrar Bv |
| oukela.com | oukela | 2012-08-15 | 2026-08-15 | 14 | Xin Net Technology Corporation |
| lorrainelowe.com | lorraine lowe | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| skl-foods.com | skl foods | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| xmxjtzs.com | xmxjtzs | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| artsinparadise.com | arts in paradise | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| 267realestate.com | 267 real estate | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| mymedicalsmartcare.com | my medical smart care | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| mauifoodtruck.com | maui food truck | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| aqengraving.com | aq engraving | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| fitinyourforties.com | fit in your forties | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| spenzanoberg.com | spenzano berg | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| laughyourselfskinnynow.com | laugh yourself skinny now | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| seguros100pre.com | seguros 100 pre | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| jasonbmcintosh.com | jason b mcintosh | 2012-08-02 | 2026-08-02 | 14 | Register.Com – Network Solutions, Llc |
| stevecreasey.com | steve creasey | 2012-08-03 | 2026-08-03 | 14 | 123-Reg Limited |
| good4biz.com | good 4 biz | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| haihuapipe.com | hai hua pipe | 2012-08-15 | 2026-08-15 | 14 | Xin Net Technology Corporation |
| ibiyou.com | i bi you | 2012-08-03 | 2026-08-03 | 14 | Spaceship, Inc. |
| trustconstruction-etobicoke.com | trust construction etobicoke | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| socialsecurityfortoday.com | social security for today | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| adlhu.com | adlhu | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| seecanyonhomes.com | see canyon homes | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| abjtravel.com | abj travel | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| rsaarcher.com | rsa archer | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| sre-holdings.com | sre holdings | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| nngxw.com | nngxw | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| opusloft.com | opus loft | 2012-08-02 | 2026-08-02 | 14 | Name.Com, Inc. |
| tobyarnoldsoundstudios.com | toby arnold sound studios | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| 6uxs.com | 6 uxs | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| xsmsm.com | xsmsm | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| apollobeachhomesforsale.com | apollo beach homes for sale | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| novalooping.com | nova looping | 2012-08-02 | 2026-08-02 | 14 | Bluehost Inc. |
| antigaybumpersticker.com | anti gay bumper sticker | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| di-mobi.com | di mobi | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| aacsaction.com | aacs action | 2012-09-18 | 2026-09-18 | 14 | Csc Corporate Domains, Inc. |
| ineskocht.com | ines kocht | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| mauivegan.com | maui vegan | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| kbral.com | kbral | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| sengdian.com | seng dian | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| android-games-magazine.com | android games magazine | 2012-10-11 | 2026-10-11 | 14 | Registrygate Gmbh |
| nathanjwyattphotography.com | nathan j wyatt photography | 2012-08-02 | 2026-08-02 | 14 | Launchpad.Com Inc. |
| kang-rong.com | kang rong | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| michaelburford.com | michael burford | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| fengshunbj.com | feng shun bj | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| makeyourplanet.com | make your planet | 2012-09-16 | 2026-09-16 | 14 | Realtime Register B.V. |
| hotproductdiscounts.com | hot product discounts | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| born2reno.com | born 2 reno | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| dogwoodchristianacademy.com | dogwood christian academy | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| reformedheart.com | reformed heart | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| myhostplanet.com | my host planet | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| caliwerks.com | cali werks | 2012-08-02 | 2026-08-02 | 14 | Network Solutions, Llc |
| jstainuo.com | jstainuo | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| servicestreetcoupons.com | service street coupons | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| namastecerromistico.com | namaste cerro mistico | 2013-06-14 | 2027-06-14 | 14 | Dattatec Corp |
| florida1realty.com | florida 1 realty | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| nk120aq.com | nk 120 aq | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| oscctv.com | os cctv | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| casanovainteriors.com | casanova interiors | 2012-08-02 | 2026-08-02 | 14 | İSimtescil Bilişim A.Ş. |
| grailconstruction.com | grail construction | 2012-08-02 | 2026-08-02 | 14 | Launchpad.Com Inc. |
| corproductions.com | cor productions | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| jsymyg.com | jsymyg | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| hanchengrzy.com | han cheng rzy | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| brettmlevine.com | brett m levine | 2012-08-02 | 2026-08-02 | 14 | Domain.Com – Network Solutions, Llc |
| yixiart.com | yi xi art | 2012-08-04 | 2026-08-04 | 14 | Dynadot |
| yourlifetakecharge.com | your life take charge | 2012-08-03 | 2026-08-03 | 14 | Bluehost Inc. |
| ditscheid.com | ditscheid | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| ccvaldevoge.com | cc valdevoge | 2013-07-10 | 2027-07-10 | 14 | Orange |
| dlatlantis.com | dl atlantis | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| enragingnews.com | enraging news | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| notaryface.com | notary face | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| fantasy-art-trading.com | fantasy art trading | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| perfectsentences.com | perfect sentences | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| rouletteitaliana.com | roulette italiana | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| s3nzanom3.com | s3nzanom3 | 2012-08-03 | 2026-08-03 | 14 | Enom, Llc |
| jmk-logistik.com | jmk logistik | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| heels-1st.com | heels 1st | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| sxjjfs.com | sxjjfs | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| gjjdyp.com | gjjdyp | 2012-08-06 | 2026-08-06 | 14 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| webuyanyleads.com | we buy any leads | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| trollsport.com | troll sport | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| ruthlesssupport.com | ruthless support | 2012-08-03 | 2026-08-03 | 14 | Wild West Domains, Llc |
| locksmithchelsea-ma.com | locksmith chelsea ma | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| iamprogay.com | i am pro gay | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| biomedicaltimes.com | biomedical times | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| objectiveoptimism.com | objective optimism | 2012-08-05 | 2026-08-05 | 14 | NameSilo |
| wrapmeasure.com | wrap measure | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| progayunite.com | pro gay unite | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| servicestreetdeals.com | service street deals | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| largolocal.com | largo local | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| mluosi.com | mluosi | 2012-08-14 | 2026-08-14 | 14 | Hefei Juming Network Technology Co., Ltd |
| thriftynatural.com | thrifty natural | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| jazresearch.com | jaz research | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| lszce.com | lszce | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| okazaki-chiryouin.com | okazaki chiryouin | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| loveisnotatriangle.com | love is not a triangle | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| earbrainexercise.com | ear brain exercise | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| proantigay.com | pro anti gay | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| lesamisgroup.com | les amis group | 2012-08-02 | 2026-08-02 | 14 | Dreamhost, Llc |
| aramingoadc.com | aramingo adc | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| warintheheavens.com | war in the heavens | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| ousportshop.com | ou sport shop | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| qiongyong.com | qiong yong | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| jetstarlet.com | jet starlet | 2012-08-01 | 2026-08-01 | 14 | Mesh Digital Limited |
| confederationofindians.com | confederation of indians | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| alittlesomethingspecialphotography.com | a little something special photography | 2012-08-03 | 2026-08-03 | 14 | Bluehost Inc. |
| willsbywaybridge.com | wills by waybridge | 2012-08-02 | 2026-08-02 | 14 | Network Solutions, Llc |
| stritzelapartments.com | stritzel apartments | 2012-08-03 | 2026-08-03 | 14 | Dnc Holdings, Inc. |
| bikelion.com | bike lion | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| medminhon.com | med min hon | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| thefreemusic.com | the free music | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| 118114jiajiao.com | 118114 jia jiao | 2012-08-06 | 2026-08-06 | 14 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| spoofos.com | spoof os | 2012-08-02 | 2026-08-02 | 14 | Key-Systems Gmbh |
| brendelproperties.com | brendel properties | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| gzy521.com | gzy 521 | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| douzang.com | dou zang | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| cooljunk4you.com | cool junk 4 you | 2012-08-02 | 2026-08-02 | 14 | Network Solutions, Llc |
| locksmithbrooklyncentermn.com | locksmith brooklyn center mn | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| daojiahui.com | dao jia hui | 2012-08-07 | 2026-08-07 | 14 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| pinna-nobilis.com | pinna nobilis | 2012-08-01 | 2026-08-01 | 14 | Key-Systems Gmbh |
| twitterna.com | twitter na | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| jacobkohutmusic.com | jacob kohut music | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| passwordsweeper.com | password sweeper | 2013-03-09 | 2027-05-14 | 14 | GoDaddy |
| thegracesalon.com | the grace salon | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| tylerreidlaw.com | tyler reid law | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| earbrainexercises.com | ear brain exercises | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| page7productions.com | page 7 productions | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| betcircuit.com | bet circuit | 2012-08-03 | 2026-08-03 | 14 | Bigrock Solutions Ltd. |
| asatvshow.com | asa tv show | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| gametuan.com | game tuan | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| testilas.com | testilas | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| transfercounselors.com | transfer counselors | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| qd-rubber.com | qd rubber | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| pointofviewweekly.com | point of view weekly | 2012-08-02 | 2026-08-02 | 14 | Bluehost Inc. |
| mcculloughministries.com | mccullough ministries | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| houdenanke.com | houden anke | 2012-08-06 | 2026-08-06 | 14 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| sofakingdemonted.com | sofa king demonted | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| phillyattys.com | philly attys | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| knfgj.com | knfgj | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| mcizcorp.com | mciz corp | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| alwaysplay4eachother.com | always play 4 each other | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| ppijakartabarat.com | ppi jakarta barat | 2012-08-08 | 2026-08-08 | 14 | Cv. Jogjacamp |
| locksmithoakdale-mn.com | locksmith oakdale mn | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| fatfreeat40.com | fat free at 40 | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| chesneyspence.com | chesney spence | 2012-09-02 | 2026-09-02 | 14 | Ionos Se |
| unitedrealestatenova.com | united real estate nova | 2012-08-02 | 2026-08-02 | 14 | Enom, Llc |
| lorinavocat.com | lorin avocat | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| reflection-office.com | reflection office | 2012-08-03 | 2026-08-03 | 14 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| tarynhipwell.com | taryn hipwell | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| 51studio.com | 51 studio | 2012-08-03 | 2026-08-03 | 14 | Spaceship, Inc. |
| jmjwilliamson.com | jmj williamson | 2012-08-03 | 2026-08-03 | 14 | Wild West Domains, Llc |
| theplasmalift.com | the plasma lift | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| cottonlabusa.com | cotton lab usa | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| rambleponder.com | ramble ponder | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| edenprairielocksmithservice.com | eden prairie locksmith service | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| downloadconference.com | download conference | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| pawsonthebeach.com | paws on the beach | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| sustainableabode.com | sustainable abode | 2012-08-02 | 2026-08-02 | 14 | Network Solutions, Llc |
| yeellx.com | yeellx | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| lepoder-psychologue.com | le poder psychologue | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| dingsang.com | ding sang | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| morisuesiks-tobitakyu.com | morisuesiks tobitakyu | 2012-08-03 | 2026-08-03 | 14 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| sunshinelindsay.com | sunshine lindsay | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| kraftoriumexports.com | kraftorium exports | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| inetwork-hoken.com | inetwork hoken | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| capitaldistricttechnometalpost.com | capital district technometal post | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| pasqualesrl.com | pasquale srl | 2012-08-28 | 2026-08-28 | 14 | Dattatec Corp |
| ricardoandronico.com | ricardo andronico | 2012-08-02 | 2026-08-02 | 14 | Internet Domain Service Bs Corp |
| naarealestate.com | naa real estate | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| seventravels.com | seven travels | 2012-08-01 | 2026-08-01 | 14 | Key-Systems Gmbh |
| alwaysplayforeachother.com | always play for each other | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| franconianotchguesthouse.com | franconia notch guesthouse | 2012-08-01 | 2026-08-01 | 14 | Domain Science Kutatási Szolgáltató Korlátolt Felelősségű Társaság |
| buymyhousethisweek.com | buy my house this week | 2013-03-01 | 2027-03-01 | 14 | GoDaddy |
| watafun.com | wata fun | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| inmesaaz.com | in mesa az | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| rsaarcherfederal.com | rsa archer federal | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| landonland.com | land on land | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| godjproductions.com | go dj productions | 2012-03-01 | 2026-11-04 | 14 | GoDaddy |
| fleetexpresstz.com | fleet express tz | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| cowprojects.com | cow projects | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| liveat7west.com | live at 7 west | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| dutchinkgallery.com | dutch ink gallery | 2012-08-02 | 2026-08-02 | 14 | Key-Systems Gmbh |
| thatbeardedmofo.com | that bearded mofo | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| jaysindianfood.com | jays indian food | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| bibliosmart.com | biblio smart | 2012-08-05 | 2026-08-05 | 14 | Cloudflare, Inc. |
| higashio.com | higashio | 2012-08-02 | 2026-08-02 | 14 | Enom, Llc |
| nammylandfilm.com | nammy land film | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| elpasohottamales.com | el paso hot tamales | 2012-08-02 | 2026-08-02 | 14 | Bluehost Inc. |
| wirteschaft.com | wirteschaft | 2013-06-09 | 2027-06-09 | 14 | Registrygate Gmbh |
| vegasbeerlovers.com | vegas beer lovers | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| ysdwq.com | ysdwq | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| aniasattic.com | anias attic | 2012-08-03 | 2026-08-03 | 14 | Network Solutions, Llc |
| hakuho-clinic.com | hakuho clinic | 2012-08-04 | 2026-08-04 | 14 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| firstpagevietnam.com | first page vietnam | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| fnspizza.com | fns pizza | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| vherf.com | vherf | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| akala-hair.com | akala hair | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| cncqxx.com | cncqxx | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| olympicclouds.com | olympic clouds | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| improgay.com | impro gay | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| estamoseguros.com | estamoseguros | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| thegypsytitmouse.com | the gypsy titmouse | 2012-08-02 | 2026-08-02 | 14 | Network Solutions, Llc |
| prateekn.com | prateek n | 2012-08-03 | 2026-08-03 | 14 | Bigrock Solutions Ltd. |
| lapichinchamuebles.com | la pichincha muebles | 2012-08-05 | 2026-08-05 | 14 | Dynadot |
| backpackandadream.com | backpack and a dream | 2012-08-02 | 2026-08-02 | 14 | Enom, Llc |
| texanjustice.com | texan justice | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| cozartmoreaulaw.com | cozart moreau law | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| seguro100pre.com | seguro 100 pre | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| vismediastore.com | vis media store | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| urlydomains.com | urly domains | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| satforboys.com | sat for boys | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| doublebroiler.com | double broiler | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| goodgravygames.com | good gravy games | 2012-08-02 | 2026-08-02 | 14 | Hostopia Canada Corp |
| tianshuimian.com | tian shui mian | 2012-08-15 | 2026-08-15 | 14 | Xin Net Technology Corporation |
| bcscharters.com | bcs charters | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| cherisheddesign.com | cherished design | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| diamantsuche.com | diamant suche | 2012-07-31 | 2026-07-31 | 14 | Internetx Gmbh |
| todaysemergencydental.com | todays emergency dental | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| moderngaygreetings.com | modern gay greetings | 2013-03-29 | 2027-03-29 | 14 | GoDaddy |
| rsanetwitnessfederal.com | rsa netwitness federal | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| atmerkezi.com | at merkezi | 2013-05-22 | 2027-05-22 | 14 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| yapayselaleciler.com | yapay selaleciler | 2012-08-02 | 2026-08-02 | 14 | İSimtescil Bilişim A.Ş. |
| jiaobanji88.com | jiaobanji 88 | 2012-08-11 | 2026-08-11 | 14 | Jiangsu Bangning Science & Technology Co. Ltd. |
| howtodolawofattraction.com | how to do law of attraction | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| iamprochickfila.com | i am pro chick fil a | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| liveatsevenwest.com | live at seven west | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| cierresgijon.com | cierres gijon | 2012-08-03 | 2026-08-03 | 14 | Name Srs Ab |
| cabinet-deslandres.com | cabinet deslandres | 2013-01-25 | 2027-01-25 | 14 | Orange |
| naplesbestplasticsurgery.com | naples best plastic surgery | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| forkliftmexico.com | forklift mexico | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| oneshotpix.com | one shot pix | 2012-08-11 | 2026-08-11 | 14 | Register Spa |
| jiyunhy.com | jiyunhy | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| mps4free.com | mps 4 free | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| socialgrouppie.com | social group pie | 2012-11-04 | 2026-11-04 | 14 | GoDaddy |
| jyymy.com | jyymy | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| aniplipis.com | aniplipis | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| anandenterprisesvalve.com | anand enterprises valve | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| estamoseguro.com | estamoseguro | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| locomomarketing.com | locomo marketing | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| kiwifruitsnzshop.com | kiwi fruits nz shop | 2012-08-01 | 2026-08-01 | 14 | Key-Systems Gmbh |
| locksmithinvergroveheights.com | locksmith inver grove heights | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| 24dreamer.com | 24 dreamer | 2012-08-06 | 2026-08-06 | 14 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| rapidstartloans.com | rapid start loans | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| bioidenticalhormonetraining.com | bioidentical hormone training | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| aiernixiang.com | ai er ni xiang | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| wyo-sla.com | wyo sla | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| pkjns.com | pkjns | 2012-08-03 | 2026-08-03 | 14 | Realtime Register B.V. |
| albertomarchiori.com | alberto marchiori | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| 1stautoconnection.com | 1st auto connection | 2012-08-03 | 2026-08-03 | 14 | Liquidnet Ltd. |
| auch-info.com | auch info | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| hibdsm.com | hibdsm | 2012-08-05 | 2026-08-05 | 14 | NameSilo |
| world-mpi.com | world mpi | 2012-08-02 | 2026-08-02 | 14 | Key-Systems Gmbh |
| sstsynths.com | sst synths | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| iqthinktank.com | iq think tank | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| locksmithchanhassen.com | locksmith chanhassen | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| wristsandankles.com | wrists and ankles | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| allaboutmadrid.com | all about madrid | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| godisantigay.com | god is anti gay | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| 0516rrzt.com | 0516 rrzt | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| toddcrowroofing.com | todd crow roofing | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| abookofsecrets.com | a book of secrets | 2012-08-02 | 2026-08-02 | 14 | Enom, Llc |
| cmcinnis.com | cm cinnis | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| servicestreethistory.com | service street history | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| ezsmokeyeyes.com | ez smokey eyes | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| pt39.com | pt 39 | 2012-08-06 | 2026-08-06 | 14 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| tesslee.com | tess lee | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| rework-service.com | rework service | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| inceptionfilms.com | inception films | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| floridahousesforpennies.com | florida houses for pennies | 2013-03-01 | 2027-03-01 | 14 | GoDaddy |
| locksmithneedham-ma.com | locksmith needham ma | 2012-08-03 | 2026-08-03 | 14 | Ionos Se |
| saiqiong.com | sai qiong | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| ayoequalsjoy.com | ayo equals joy | 2012-08-01 | 2026-08-01 | 14 | Porkbun Llc |
| living-ladolcevita.com | living la dolce vita | 2012-11-04 | 2026-11-04 | 14 | GoDaddy |
| grandnationalshow.com | grand national show | 2012-08-04 | 2026-08-04 | 14 | Register.Ca Inc. |
| android4business.com | android 4 business | 2012-10-11 | 2026-10-11 | 14 | Registrygate Gmbh |
| reinventa12.com | reinventa 12 | 2012-08-05 | 2026-08-05 | 14 | Dinahosting S.L. |
| familyfunfair.com | family fun fair | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| business-law-attorneys.com | business law attorneys | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| towniesgrill.com | townies grill | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| victorrlee.com | victor r lee | 2012-08-14 | 2026-08-14 | 14 | Webnames.Ca Inc. |
| clintflanaganmd.com | clint flanagan md | 2012-08-01 | 2026-08-01 | 14 | Name.Com, Inc. |
| tarmacspv.com | tarmac spv | 2012-09-18 | 2026-09-18 | 14 | Csc Corporate Domains, Inc. |
| ashtonvetclinic.com | ashton vet clinic | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| locksmithweymouthma.com | locksmith weymouth ma | 2012-08-03 | 2026-08-03 | 14 | Ionos Se |
| chalkboard-math.com | chalkboard math | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| qjryfpc.com | qjryfpc | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| bankcreditcardrewards.com | bank credit card rewards | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| weston-vermont.com | weston vermont | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| selcy-blog.com | selcy blog | 2012-09-14 | 2026-09-14 | 14 | Idc Frontier Inc. |
| grahamanthonyharris.com | graham anthony harris | 2012-08-03 | 2026-08-03 | 14 | Bluehost Inc. |
| newcaramerica.com | new car america | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| tilyasuck.com | tilya suck | 2012-06-29 | 2026-09-13 | 14 | GoDaddy |
| servicestreetnews.com | service street news | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| excesstc.com | excess tc | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| mezesa.com | mezesa | 2012-08-01 | 2026-08-01 | 14 | Sav.Com, Llc |
| wonkystore.com | wonky store | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| appliancerepaircda.com | appliance repair cda | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| winn-technology.com | winn technology | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| nnjas.com | nnjas | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| antigayunite.com | anti gay unite | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| freelancerausbildung.com | freelancer ausbildung | 2012-08-01 | 2026-08-01 | 14 | United-Domains Gmbh |
| heatheremcfarlane.com | heather e mcfarlane | 2012-08-04 | 2026-08-04 | 14 | Easydns Technologies Inc. |
| xanthangumsubstitute.com | xanthan gum substitute | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| operationaldoctrine.com | operational doctrine | 2012-08-05 | 2026-08-05 | 14 | Dynadot |
| pawncow.com | pawn cow | 2012-08-02 | 2026-08-02 | 14 | Bluehost Inc. |
| braklowhomes.com | braklow homes | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| a3thinker.com | a3 thinker | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| vetclinictampa.com | vet clinic tampa | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| richardmarshphotography.com | richard marsh photography | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| kufeer.com | kufeer | 2012-08-07 | 2026-08-07 | 14 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| antichickfila.com | anti chick fil a | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| sulrossdanceclub.com | sul ross dance club | 2012-08-02 | 2026-08-02 | 14 | Domain.Com – Network Solutions, Llc |
| mcdinternational.com | mcd international | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| eliteprotectioninvestigation.com | elite protection investigation | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| hellolets.com | hello lets | 2012-08-05 | 2026-08-05 | 14 | Cloudflare, Inc. |
| studentnofee.com | student no fee | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| pmutracker.com | pmu tracker | 2012-08-01 | 2026-08-01 | 14 | Name.Com, Inc. |
| satforgirls.com | sat for girls | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| thebaruch.com | the baruch | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| ridethethundermovie.com | ride the thunder movie | 2012-11-04 | 2026-11-04 | 14 | GoDaddy |
| alittlesomethingphotography.com | a little something photography | 2012-08-02 | 2026-08-02 | 14 | Bluehost Inc. |
| sardaenterprises.com | sarda enterprises | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| wonkyfund.com | wonky fund | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| livingwheatgrass.com | living wheatgrass | 2012-08-05 | 2026-08-05 | 14 | Cloudflare, Inc. |
| cardrewardscomparison.com | card rewards comparison | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| godahuo.com | go da huo | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| impol-hu.com | impol hu | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| industrialmovingsolutions.com | industrial moving solutions | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| mariosulit.com | mario sulit | 2012-08-02 | 2026-08-02 | 14 | Dreamhost, Llc |
| stpsychologicalservices.com | st psychological services | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| smartdentals.com | smart dentals | 2012-08-03 | 2026-08-03 | 14 | Enom, Llc |
| power4projects.com | power 4 projects | 2012-08-02 | 2026-08-02 | 14 | Key-Systems Gmbh |
| pimspropertymanagement.com | pims property management | 2012-08-03 | 2026-08-03 | 14 | 123-Reg Limited |
| antigaypower.com | anti gay power | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| bigcatsailing.com | big cat sailing | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| lecercle-ew.com | le cercle ew | 2012-08-02 | 2026-08-02 | 14 | Register.Com – Network Solutions, Llc |
| njfyjc.com | njfyjc | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| spanishhandicrafts.com | spanish handicrafts | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| webagenci.com | web agenci | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| 64sys.com | 64 sys | 2012-08-02 | 2026-08-02 | 14 | Network Solutions, Llc |
| globalbewell.com | global be well | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| syshzb.com | sys hzb | 2012-08-14 | 2026-08-14 | 14 | Gname.Com Pte. Ltd. |
| real-estate-business-law.com | real estate business law | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| helpforagingveterans.com | help for aging veterans | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| faithfulanddevoted.com | faithful and devoted | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| easterntractor.com | eastern tractor | 2012-08-02 | 2026-08-02 | 14 | Enom, Llc |
| diligenciasrd.com | diligencias rd | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| hubaotv.com | hu bao tv | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| lonestargriffons.com | lone star griffons | 2012-08-04 | 2026-08-04 | 14 | NameSilo |
| ruhunbakimevi.com | ruhun bakimevi | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| carolina-accessibility.com | carolina accessibility | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| melemelemusic.com | melemele music | 2012-09-13 | 2026-09-13 | 14 | GoDaddy |
| dikeyinternational.com | dikey international | 2012-08-02 | 2026-08-02 | 14 | İSimtescil Bilişim A.Ş. |
| lwxry.com | lwxry | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| locksmithlakevillemn.com | locksmith lakeville mn | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| meierpu.com | meier pu | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| xn--eckybyf9dr38vlr3agx8a.com | xn--eckybyf9dr38vlr3agx8a | 2012-08-03 | 2026-08-03 | 14 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| generationcourage.com | generation courage | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| tadagirls.com | tada girls | 2012-08-02 | 2026-08-02 | 14 | Hostopia Canada Corp |
| opera-digitale.com | opera digitale | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| phillyatty.com | philly atty | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| computermerchants.com | computer merchants | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| williamsgenerator.com | williams generator | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| tapasbeer.com | tapas beer | 2012-08-09 | 2026-08-09 | 14 | Ionos Se |
| wristandankle.com | wrist and ankle | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| hobbyhousebangkok.com | hobby house bangkok | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| tudietistadeconfianza.com | tu dietista de confianza | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| charitychallengers.com | charity challengers | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| cndf-web.com | cndf web | 2012-08-03 | 2026-08-03 | 14 | Name Srs Ab |
| locksmithsalemma.com | locksmith salem ma | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| nodepbonus.com | no dep bonus | 2012-08-01 | 2026-08-01 | 14 | Name.Com, Inc. |
| broadsabroadtravel.com | broads abroad travel | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| vitaminshred.com | vitamin shred | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| wrapquoter.com | wrap quoter | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| legalfirmindia.com | legal firm india | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| playamayayucatan.com | playa maya yucatan | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| ahczzhsl.com | ahczzhsl | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| judoclubeckbo.com | judo club eckbo | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| ynzzyj.com | ynzzyj | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| qunnuan.com | qun nuan | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| locksmithsavagemn.com | locksmith savage mn | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| locksmithbraintree-ma.com | locksmith braintree ma | 2012-08-03 | 2026-08-03 | 14 | Ionos Se |
| rentahvar.com | rent a hvar | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| bbqpitmistress.com | bbq pit mistress | 2012-08-04 | 2026-08-04 | 14 | GoDaddy |
| crowdfunding-italia.com | crowdfunding italia | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| homeforbacktaxes.com | home for back taxes | 2013-03-01 | 2027-03-01 | 14 | GoDaddy |
| anitgaysunite.com | anitgaysunite | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| miguelalmario.com | miguel almario | 2012-08-03 | 2026-08-03 | 14 | Enom, Llc |
| suzanne-van-stralen.com | suzanne van stralen | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| adrenalin-deals.com | adrenalin deals | 2012-10-22 | 2026-10-22 | 14 | Registrygate Gmbh |
| ledbetterfitness.com | ledbetter fitness | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| millionaireintherough.com | millionaire in the rough | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| progaysunite.com | progaysunite | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| jujtec.com | jujtec | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| sarahbmcintyre.com | sarah b mcintyre | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| appliancetechparts.com | appliance tech parts | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| ybxy2010.com | ybxy 2010 | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| djzce.com | djzce | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| envisonsports.com | envison sports | 2012-08-02 | 2026-08-02 | 14 | Bluehost Inc. |
| vestacontinental.com | vesta continental | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| amatuars.com | amatuars | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| chromohealth.com | chromo health | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| hotelco2.com | hotel co2 | 2012-08-02 | 2026-08-02 | 14 | Launchpad.Com Inc. |
| blagwq.com | blagwq | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| umvotiwellness.com | umvoti wellness | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| rebbekkarama.com | rebbekka rama | 2012-08-03 | 2026-08-03 | 14 | Realtime Register B.V. |
| geocandy.com | geo candy | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| xzsfyc.com | xzsfyc | 2012-08-01 | 2026-08-01 | 14 | Chengdu West Dimension Digital Technology Co., Ltd. |
| thepassionateprofessional.com | the passionate professional | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| miniairpump.com | mini air pump | 2012-08-05 | 2026-08-05 | 14 | NameSilo |
| maxinemarcelino.com | maxine marcelino | 2012-08-02 | 2026-08-02 | 14 | Bluehost Inc. |
| ricardonolte.com | ricardo nolte | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| sat4girls.com | sat 4 girls | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| thestritz.com | the stritz | 2012-08-03 | 2026-08-03 | 14 | Dnc Holdings, Inc. |
| locksmithbeverlyma.com | locksmith beverly ma | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| bonuserotic.com | bonus erotic | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| elektroeroziya.com | elektro eroziya | 2012-08-10 | 2026-08-10 | 14 | Regional Network Information Center, Jsc Dba Ru-Center |
| jdmrosemaryrun.com | jdm rosemary run | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| socalenvironmentaltesting.com | so cal environmental testing | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| thereelestatecompany.com | the reel estate company | 2012-08-02 | 2026-08-02 | 14 | Launchpad.Com Inc. |
| rsanetwitness.com | rsa net witness | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| cstyleboards.com | c style boards | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| addpractice.com | add practice | 2012-09-14 | 2026-09-14 | 14 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| cyzrw.com | cyzrw | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| dongmiu.com | dong miu | 2012-08-07 | 2026-08-07 | 14 | 22Net, Inc. |
| pack3310-atl.com | pack 3310 atl | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| yourstorypro.com | your story pro | 2013-08-03 | 2027-08-04 | 14 | GoDaddy |
| seconddemocracy.com | second democracy | 2012-08-04 | 2026-08-04 | 14 | Turncommerce, Inc. Dba Namebright.Com |
| caroladearmas.com | carola de armas | 2012-08-03 | 2026-08-03 | 14 | Namecheap |
| unitedrealestatemd.com | united real estate md | 2012-08-02 | 2026-08-02 | 14 | Enom, Llc |
| unicecare.com | unice care | 2012-08-13 | 2026-08-13 | 14 | Gname.Com Pte. Ltd. |
| locksmithblainemn.com | locksmith blaine mn | 2012-08-02 | 2026-08-02 | 14 | Ionos Se |
| knowstepbystep.com | know step by step | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| anne-donovan-painter.com | anne donovan painter | 2012-08-02 | 2026-08-02 | 14 | Network Solutions, Llc |
| bbpermits.com | bb permits | 2012-08-04 | 2026-08-04 | 14 | Tucows Domains Inc. |
| whatiscalled.com | what is called | 2012-08-03 | 2026-08-03 | 14 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| stovecorner.com | stove corner | 2012-08-03 | 2026-08-03 | 14 | 123-Reg Limited |
| construction-law-litigation.com | construction law litigation | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| securetimeonline.com | secure time online | 2012-08-02 | 2026-08-02 | 14 | Key-Systems Gmbh |
| fatfreeatforty.com | fat free at forty | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| raspiface.com | raspi face | 2012-08-03 | 2026-08-03 | 14 | GoDaddy |
| futureforcepersonel.com | future force personel | 2013-08-03 | 2026-08-03 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| finchatwardendentistry.com | finch at warden dentistry | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| thescarfbar.com | the scarf bar | 2013-11-04 | 2026-11-04 | 13 | GoDaddy |
| plasticsurgeryaesthetic.com | plastic surgery aesthetic | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| guidelk.com | guide lk | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| wonderwallpictures.com | wonder wall pictures | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| gztuiguang.com | gz tuiguang | 2013-08-07 | 2026-08-07 | 13 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| mechou.com | mechou | 2013-08-02 | 2026-08-02 | 13 | Name.Com, Inc. |
| mainlineprep.com | mainline prep | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| xn--fjqs68c4hf3wi.com | xn--fjqs68c4hf3wi | 2013-08-07 | 2026-08-07 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| ec-realnet.com | ec real net | 2013-08-02 | 2026-08-02 | 13 | Xserver, Inc. |
| sibscript.com | sib script | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| xl16.com | xl 16 | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| himipopo.com | himi popo | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| dmetalworks.com | d metal works | 2013-08-04 | 2026-08-04 | 13 | NameSilo |
| hotgaytubeporn.com | hot gay tube porn | 2013-08-02 | 2026-08-02 | 13 | Danesco Trading Ltd. |
| cassandrawallace.com | cassandra wallace | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| scentsofsanfrancisco.com | scents of san francisco | 2013-09-13 | 2026-09-13 | 13 | GoDaddy |
| qbjggzy.com | qbj ggzy | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| frantomdevelopments.com | frantom developments | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| kaifucapital.com | kai fu capital | 2013-11-04 | 2026-11-04 | 13 | GoDaddy |
| rattraymarsh.com | rattray marsh | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| reid-family.com | reid family | 2013-08-27 | 2026-11-04 | 13 | Wild West Domains, Llc |
| geeksguidetopittsburgh.com | geeks guide to pittsburgh | 2013-08-04 | 2026-08-04 | 13 | Wild West Domains, Llc |
| publireportagen.com | publi reportagen | 2013-10-09 | 2026-10-09 | 13 | Registrygate Gmbh |
| sxsth.com | sxsth | 2013-08-15 | 2026-08-15 | 13 | Xin Net Technology Corporation |
| naughtybooksnitch.com | naughty book snitch | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| calgaryabservices.com | calgary ab services | 2013-08-03 | 2026-08-03 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| kaihonglogistics.com | kai hong logistics | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| societywolf.com | society wolf | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| losangeles-carpetcleaning.com | los angeles carpet cleaning | 2013-08-03 | 2026-08-03 | 13 | Bluehost Inc. |
| fastpcrepairs.com | fast pc repairs | 2013-08-04 | 2026-08-04 | 13 | Domaindelights Llc |
| maelinec.com | maelinec | 2013-08-03 | 2026-08-03 | 13 | Bluehost Inc. |
| zhaijv.com | zhai jv | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| resourcerep.com | resource rep | 2013-08-02 | 2026-08-02 | 13 | Bluehost Inc. |
| gspicoatings.com | gspi coatings | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| songsmithcreative.com | song smith creative | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| anssales.com | ans sales | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| hardcoregaytubeporn.com | hardcore gay tube porn | 2013-08-02 | 2026-08-02 | 13 | Danesco Trading Ltd. |
| cpsgaza.com | cps gaza | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| wandarriquarries.com | wandarri quarries | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| jh-ate.com | jh ate | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| ameliabrantley.com | amelia brantley | 2013-08-02 | 2026-08-02 | 13 | Launchpad.Com Inc. |
| ankate.com | ankate | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| evideocard.com | e video card | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| flatironleather.com | flatiron leather | 2013-09-13 | 2026-09-13 | 13 | GoDaddy |
| antinghospital.com | anting hospital | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| davidmcintoshphotography.com | david mcintosh photography | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| orionsex.com | orion sex | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| vaniaedrea.com | vania edrea | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| bestcongress.com | best congress | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| meanderteckels.com | meander teckels | 2013-08-05 | 2026-08-05 | 13 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| afeze.com | afeze | 2013-08-04 | 2026-08-04 | 13 | Tucows Domains Inc. |
| shockando.com | shock and o | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| rispandu.com | rispandu | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| 51jinshu.com | 51 jin shu | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| itcamefromthe.com | it came from the | 2013-08-02 | 2026-08-02 | 13 | Domain.Com – Network Solutions, Llc |
| shfengyu.com | sh feng yu | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| poloniacup.com | polonia cup | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| marry-me-vintage.com | marry me vintage | 2013-11-05 | 2026-11-05 | 13 | GoDaddy |
| jimmygarage.com | jimmy garage | 2013-11-04 | 2026-11-04 | 13 | GoDaddy |
| 5656777.com | 5656777 | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| sungbulsa.com | sung bul sa | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| ychhsxy.com | ychhsxy | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| clubwod.com | club wod | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| securechan.com | secure chan | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| dokatools.com | doka tools | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| kosherbalkan.com | kosher balkan | 2013-08-04 | 2026-08-04 | 13 | Tucows Domains Inc. |
| apsleydomesticcleaners.com | apsley domestic cleaners | 2013-08-01 | 2026-08-01 | 13 | Mesh Digital Limited |
| cabracounselling.com | cabra counselling | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| kilotourisme.com | kilo tourisme | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| bloggerchallenge.com | blogger challenge | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| cc-stm.com | cc stm | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| calilovewear.com | cali love wear | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| macometisposi.com | macomet isposi | 2013-08-04 | 2026-08-04 | 13 | Tucows Domains Inc. |
| qtcwl.com | qtcwl | 2013-08-13 | 2026-08-13 | 13 | Shanghai Meicheng Technology Information Development Co., Ltd. |
| zgsljyw.com | zgsljyw | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| usashirtshop.com | usa shirt shop | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| glennricenovels.com | glenn rice novels | 2013-08-02 | 2026-08-02 | 13 | Bluehost Inc. |
| designlivingna.com | design living na | 2013-08-04 | 2026-08-04 | 13 | Tucows Domains Inc. |
| livlim.com | liv lim | 2013-08-20 | 2026-08-20 | 13 | Br Domain Inc. Dba Namegear.Co |
| beiruis.com | beiruis | 2013-08-13 | 2026-08-13 | 13 | Shanghai Meicheng Technology Information Development Co., Ltd. |
| millionquid.com | million quid | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| kingsmtminis.com | kings mt minis | 2013-08-02 | 2026-08-02 | 13 | Domain.Com – Network Solutions, Llc |
| marygolddelivery.com | mary gold delivery | 2013-08-02 | 2026-08-02 | 13 | Register.Com – Network Solutions, Llc |
| havanascontemporarymuseumofart.com | havanas contemporary museum of art | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| seyrikonya.com | seyri konya | 2013-08-02 | 2026-08-02 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| chongwurenjia.com | chong wu ren jia | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| impossibledata.com | impossible data | 2013-08-04 | 2026-08-04 | 13 | NameSilo |
| epubpan.com | epub pan | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| knowme2helpme.com | know me 2 help me | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| smezxyy.com | smezxyy | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| unitedwestandshop.com | united we stand shop | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| puertasautomaticasyaley.com | puertas automaticas ya ley | 2013-08-03 | 2026-08-03 | 13 | Wild West Domains, Llc |
| tlmanagement.com | tl management | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| iotspy.com | iot spy | 2013-09-20 | 2026-09-20 | 13 | Inwx Gmbh |
| magcsconsultancyltd.com | magcs consultancy ltd | 2013-08-03 | 2026-08-03 | 13 | 123-Reg Limited |
| selecta-bag.com | selecta bag | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| balti-palace.com | balti palace | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| baxaartacademy.com | baxa art academy | 2013-08-02 | 2026-08-02 | 13 | Domain.Com – Network Solutions, Llc |
| livingspaceandpartners.com | living space and partners | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| realmotorclubofamerica.com | real motor club of america | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| labtrainers.com | lab trainers | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| ubccubeclub.com | ubc cube club | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| saisteelcorp.com | sai steel corp | 2013-08-03 | 2026-08-03 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| kougoblog.com | kougo blog | 2013-08-02 | 2026-08-02 | 13 | Xserver, Inc. |
| lizabethczepiel.com | lizabeth czepiel | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| collisterjohnson.com | collister johnson | 2014-02-13 | 2027-02-13 | 13 | Vautron Rechenzentrum Ag |
| mattiewatkins.com | mattie watkins | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| unsworthbros.com | unsworth bros | 2016-08-04 | 2029-08-04 | 13 | GoDaddy |
| groupethetis.com | groupe thetis | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| newnanseo.com | newnan seo | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| hongyungongsi.com | hong yun gong si | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| realjamaicantelevision.com | real jamaican television | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| irmarantala.com | irma rantala | 2013-08-03 | 2026-08-03 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| balletextension.com | ballet extension | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| xuanweiqk.com | xuan wei qk | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| marketing68.com | marketing 68 | 2014-07-30 | 2027-07-30 | 13 | Key-Systems Gmbh |
| hollywooddistillers.com | hollywood distillers | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| bambooservice.com | bamboo service | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| shanxicjh.com | shanxi cjh | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| carstree.com | cars tree | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| saddletimeissuccess.com | saddle time is success | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| ghglobaltrading.com | gh global trading | 2013-08-02 | 2026-08-02 | 13 | Register.Com – Network Solutions, Llc |
| lflhch.com | lflhch | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| warneking.com | warneking | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| naturfitshoes.com | natur fit shoes | 2013-08-02 | 2026-08-02 | 13 | Register.Com – Network Solutions, Llc |
| in-ballet.com | in ballet | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| marinadist.com | marina dist | 2013-08-02 | 2026-08-02 | 13 | Register.Com – Network Solutions, Llc |
| rixmaestro.com | rix maestro | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| xfl-acrylic.com | xfl acrylic | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| yyyl666.com | yyyl 666 | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| isabelcarr.com | isabel carr | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| wiisportsclub.com | wii sports club | 2013-09-18 | 2026-09-18 | 13 | Csc Corporate Domains, Inc. |
| purpulle.com | purpulle | 2013-08-03 | 2026-08-03 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| myfastservers.com | my fast servers | 2013-08-05 | 2026-08-05 | 13 | Cloudflare, Inc. |
| carletonlacrosse.com | carleton lacrosse | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| allendav.com | allen dav | 2013-08-02 | 2026-08-02 | 13 | Bluehost Inc. |
| gayfucktubeporn.com | gay fuck tube porn | 2013-08-02 | 2026-08-02 | 13 | Danesco Trading Ltd. |
| cyber-campus.com | cyber campus | 2013-09-13 | 2026-09-13 | 13 | Ionos Se |
| spiritcrossway.com | spirit crossway | 2013-08-02 | 2026-08-02 | 13 | Domain.Com – Network Solutions, Llc |
| rippedlikeawrestler.com | ripped like a wrestler | 2013-11-18 | 2026-11-18 | 13 | GoDaddy |
| gaypornmoviestube.com | gay porn movies tube | 2013-08-02 | 2026-08-02 | 13 | Danesco Trading Ltd. |
| czechpremium.com | czech premium | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| offtheshelf-payroll.com | off the shelf payroll | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| dimpossible.com | d impossible | 2013-08-04 | 2026-08-04 | 13 | NameSilo |
| bostonbusinessconnect.com | boston business connect | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| perrypu.com | perry pu | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| cecilefagot.com | cecile fagot | 2013-08-12 | 2026-08-12 | 13 | Register Spa |
| triptobliss.com | trip to bliss | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| estudioinput.com | estudio input | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| sbrconnections.com | sbr connections | 2013-08-02 | 2026-08-02 | 13 | Enom, Llc |
| csmstrategy.com | csm strategy | 2013-08-03 | 2026-08-03 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| jcttip.com | jct tip | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| myleadconsultant.com | my lead consultant | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| sendaschnell.com | senda schnell | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| listerprofile.com | lister profile | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| soojd.com | soojd | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| shanghaiguolu.com | shanghai guo lu | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| ghonlinemarketing.com | gh online marketing | 2013-08-02 | 2026-08-02 | 13 | Key-Systems Gmbh |
| docservir.com | doc servir | 2013-08-02 | 2026-08-02 | 13 | Enom, Llc |
| theshelteringoak.com | the sheltering oak | 2014-03-06 | 2027-03-06 | 13 | Wild West Domains, Llc |
| whitewhim.com | white whim | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| lengthxwit.com | length x wit | 2013-08-02 | 2026-08-02 | 13 | Dreamhost, Llc |
| sospaybills.com | sos pay bills | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| mybouldercondoguy.com | my boulder condo guy | 2013-08-05 | 2026-08-05 | 13 | Pair Networks, Inc. D/B/A Pair Domains |
| xn--u9jugne8gb4976bghwqxlvz9g.com | xn--u9jugne8gb4976bghwqxlvz9g | 2013-08-03 | 2026-08-03 | 13 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| togetherinmercy.com | together in mercy | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| virtualdubformac.com | virtual dub for mac | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| gaofangmaotaijiu.com | gao fang mao tai jiu | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| hairlinexclusive.com | hairline xclusive | 2013-11-05 | 2026-11-05 | 13 | GoDaddy |
| cis-paris.com | cis paris | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| durakcell.com | durak cell | 2013-08-15 | 2026-08-15 | 13 | Sh Online İLetişIm A.Ş. |
| shjsxs.com | shjsxs | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| showmetigers.com | show me tigers | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| lipolongisland.com | lipo long island | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| websolutionswizardtestzone2.com | web solutions wizard test zone 2 | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| lyndashair.com | lyndas hair | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| francisrjhawkins.com | francis r j hawkins | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| verger-bfoujanet.com | verger b foujanet | 2013-11-08 | 2026-11-08 | 13 | Orange |
| basswhooping.com | bass whooping | 2013-08-03 | 2026-08-03 | 13 | Liquidnet Ltd. |
| ahsjm.com | ahsjm | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| spirit-shirt.com | spirit shirt | 2013-08-01 | 2026-08-01 | 13 | Mesh Digital Limited |
| hannahschool.com | hannah school | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| 888999888.com | 888999888 | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| covingtonleephotography.com | covington lee photography | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| thebouldercondoguy.com | the boulder condo guy | 2013-08-05 | 2026-08-05 | 13 | Pair Networks, Inc. D/B/A Pair Domains |
| communitydialog.com | community dialog | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| jssylb.com | jssylb | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| adqzby.com | adqzby | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| miomomente.com | mio momente | 2013-08-02 | 2026-08-02 | 13 | Key-Systems Gmbh |
| benjwalden.com | benj walden | 2013-08-03 | 2026-08-03 | 13 | Liquidnet Ltd. |
| 506docs.com | 506 docs | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| toycamera-tanoshimu.com | toy camera tanoshimu | 2013-08-03 | 2026-08-03 | 13 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| baruurbano.com | baru urbano | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| gressenhall.com | gressenhall | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| knowledgehandbook.com | knowledge handbook | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| lokhard.com | lokhard | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| ohiostatenergy.com | ohio stat energy | 2013-11-04 | 2026-11-04 | 13 | Wild West Domains, Llc |
| shshigan.com | shshigan | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| tuijavirta.com | tuija virta | 2013-08-02 | 2026-08-02 | 13 | Key-Systems Gmbh |
| o-h-i-o-energy.com | o h i o energy | 2013-11-04 | 2026-11-04 | 13 | Wild West Domains, Llc |
| steven-senkus.com | steven senkus | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| cdjiuyun.com | cd jiuyun | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| rarepigs.com | rare pigs | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| xmjiachen.com | xm jiachen | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| andreajensen.com | andrea jensen | 2013-08-02 | 2026-08-02 | 13 | Annulet Llc |
| cubenco.com | cubenco | 2013-08-06 | 2026-08-06 | 13 | Gabia, Inc. |
| iheartburningman.com | i heart burning man | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| birthtoberfest.com | birth toberfest | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| penanddesign.com | pen and design | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| racetruckbykiba.com | race truck by kiba | 2013-08-02 | 2026-08-02 | 13 | Xserver, Inc. |
| mind-guard.com | mind guard | 2014-08-16 | 2027-08-16 | 13 | Mesh Digital Limited |
| gerenciandoriscosemprojetos.com | gerenciando riscos em projetos | 2013-08-03 | 2026-08-03 | 13 | Enom, Llc |
| einsteintraining.com | einstein training | 2013-08-02 | 2026-08-02 | 13 | Domain.Com – Network Solutions, Llc |
| hotelede.com | hotel ede | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| kindamoody.com | kinda moody | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| sebsoler.com | seb soler | 2014-04-04 | 2027-04-04 | 13 | GoDaddy |
| whitenoiseav.com | white noise av | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| linkingittogether.com | linking it together | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| cqwanhedq.com | cqwanhedq | 2013-08-04 | 2026-08-04 | 13 | Dynadot |
| hirisetek.com | hirisetek | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| send-free-texts.com | send free texts | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| thenextbuilding.com | the next building | 2013-08-02 | 2026-08-02 | 13 | Enom, Llc |
| chathamairportlimo.com | chatham airport limo | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| amandahoelzeman.com | amanda hoelzeman | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| bjgold186.com | bj gold 186 | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| madebycay.com | made by cay | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| figurativebronze.com | figurative bronze | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| ptfejointsealant.com | ptfe joint sealant | 2014-02-09 | 2027-02-09 | 13 | GoDaddy |
| xzsj56.com | xzsj 56 | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| buckshees.com | buckshees | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| sh-aiyin.com | sh aiyin | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| finefaux.com | fine faux | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| hainanjiancai.com | hai nan jian cai | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| research-transfer.com | research transfer | 2013-10-17 | 2026-10-17 | 13 | Internetx Gmbh |
| basinternal.com | bas internal | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| evernetika.com | evernetika | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| visiontengroup.com | vision ten group | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| dsf-service.com | dsf service | 2013-08-28 | 2026-08-28 | 13 | Dattatec Corp |
| internpage.com | intern page | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| blslibrary.com | bls library | 2013-08-02 | 2026-08-02 | 13 | Dreamhost, Llc |
| mindguards.com | mind guards | 2014-08-16 | 2027-08-16 | 13 | Mesh Digital Limited |
| 3358888.com | 3358888 | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| france-elevage.com | france elevage | 2013-11-08 | 2026-11-08 | 13 | Orange |
| tamara-austin.com | tamara austin | 2013-09-12 | 2026-09-12 | 13 | GoDaddy |
| kathryn-profile.com | kathryn profile | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| y-men.com | y men | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| novaspac.com | novaspac | 2013-08-15 | 2026-08-15 | 13 | Regtime Ltd. |
| vwxwv.com | vwxwv | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| chicagobearboards.com | chicago bear boards | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| ixchel-esty.com | ixchel esty | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| mima-artblog.com | mima art blog | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| brucesmlee.com | bruce s m lee | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| exoticfelineboutique.com | exotic feline boutique | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| tcrickphoto.com | t crick photo | 2013-07-04 | 2026-08-02 | 13 | Key-Systems Gmbh |
| chatbrute.com | chat brute | 2013-08-03 | 2026-08-03 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| chiselerslist.com | chiselers list | 2013-11-05 | 2026-11-05 | 13 | GoDaddy |
| akua2013.com | akua 2013 | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| wei360.com | wei 360 | 2013-08-15 | 2026-08-15 | 13 | Dnspod, Inc. |
| cravewinmarketing.com | crave win marketing | 2013-08-02 | 2026-08-02 | 13 | Porkbun Llc |
| davescornergarage.com | daves corner garage | 2013-09-13 | 2026-09-13 | 13 | GoDaddy |
| thecompassionatemd.com | the compassionate md | 2013-08-05 | 2026-08-05 | 13 | Rebel Ltd |
| atlvapor.com | atl vapor | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| justjacob.com | just jacob | 2013-08-02 | 2026-08-02 | 13 | Dreamhost, Llc |
| hyxjz.com | hyxjz | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| j18s.com | j 18 s | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| apjingang.com | ap jingang | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| 5317u.com | 5317 u | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| chathamcarservices.com | chatham car services | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| studentcreditloan.com | student credit loan | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| koyo168.com | koyo 168 | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| naturevending.com | nature vending | 2013-11-05 | 2026-11-05 | 13 | GoDaddy |
| versatiletransfer.com | versatile transfer | 2015-02-10 | 2028-02-10 | 13 | GoDaddy |
| bjshengyehongtian.com | bj sheng ye hong tian | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| luxurymarketadvisors.com | luxury market advisors | 2013-08-02 | 2026-08-02 | 13 | Domain.Com – Network Solutions, Llc |
| veggycurious.com | veggy curious | 2014-08-04 | 2027-08-05 | 13 | GoDaddy |
| veterancross.com | veteran cross | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| thejebbushdaily.com | the jeb bush daily | 2013-08-02 | 2026-08-02 | 13 | Moniker Online Services Llc |
| mikejleopold.com | mike j leopold | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| zhandage.com | zhan da ge | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| chickenfuckermagazine.com | chicken fucker magazine | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| jamiekitchen.com | jamie kitchen | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| ger5148.com | ger 5148 | 2013-08-03 | 2026-08-03 | 13 | Wild West Domains, Llc |
| ellastvroku.com | ellas tv roku | 2014-04-26 | 2027-04-26 | 13 | GoDaddy |
| mvmpolacherry.com | mvm pola cherry | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| intergralcs.com | intergral cs | 2013-08-03 | 2026-08-03 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| comnexity.com | comnexity | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| zc2002.com | zc 2002 | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| knowmetohelpme.com | know me to help me | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| pawscritters.com | paws critters | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| fenghuangziben.com | feng huang zi ben | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| szrdhj.com | szrdhj | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| ctshi.com | ctshi | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| mopegrup.com | mope grup | 2013-08-03 | 2026-08-03 | 13 | Soluciones Corporativas Ip, Sl |
| ksyoungtec.com | ks young tec | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| baydatraducciones.com | bayda traducciones | 2013-08-02 | 2026-08-02 | 13 | Key-Systems Gmbh |
| aidanmacisaac.com | aidan macisaac | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| paperscheck.com | papers check | 2013-10-24 | 2026-08-03 | 13 | Wild West Domains, Llc |
| tastyfoodphotography.com | tasty food photography | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| playgroundborder.com | playground border | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| gaypornvideostube.com | gay porn videos tube | 2013-08-02 | 2026-08-02 | 13 | Danesco Trading Ltd. |
| cubastudentstours.com | cuba students tours | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| frescointavola.com | fresco in tavola | 2013-08-05 | 2026-08-05 | 13 | Onlinenic, Inc. |
| sexydessou.com | sexy dessou | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| 5starssolar.com | 5 stars solar | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| affordablewindowsnow.com | affordable windows now | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| colitico.com | colitico | 2013-08-05 | 2026-08-05 | 13 | Dynadot |
| ulticoldpave.com | ulti cold pave | 2013-09-18 | 2026-09-18 | 13 | Csc Corporate Domains, Inc. |
| progolfstar.com | pro golf star | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| bidballs.com | bid balls | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| sqsky.com | sq sky | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| nobita1069.com | nobita 1069 | 2013-08-05 | 2026-08-05 | 13 | Dynadot |
| nsadefense.com | nsa defense | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| ottawacondovalue.com | ottawa condo value | 2013-09-12 | 2026-09-12 | 13 | GoDaddy |
| sap-idoc2edi-consulting.com | sap idoc 2 edi consulting | 2013-08-02 | 2026-08-02 | 13 | Key-Systems Gmbh |
| plan-new.com | plan new | 2013-08-02 | 2026-08-02 | 13 | Xserver, Inc. |
| afreve.com | afreve | 2013-08-02 | 2026-08-02 | 13 | Bluehost Inc. |
| kasanelow.com | kasane low | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| app2datemyson.com | app 2 date my son | 2013-08-02 | 2026-08-02 | 13 | Launchpad.Com Inc. |
| 593buy.com | 593 buy | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| lademestria.com | la demestria | 2014-03-14 | 2027-03-14 | 13 | Ovh Sas |
| chengronglihua.com | cheng rong li hua | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| kellydemo.com | kelly demo | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| ccrmediation.com | ccr mediation | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| digitalwebhq.com | digital web hq | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| cubaartmuseum.com | cuba art museum | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| boss-crm.com | boss crm | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| freeforwebdesign.com | free for web design | 2013-08-05 | 2026-08-05 | 13 | Dynadot |
| freedomprovisioncompany.com | freedom provision company | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| watchmylasik.com | watch my lasik | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| loansss.com | loansss | 2013-08-04 | 2026-08-04 | 13 | Dynadot |
| thescarfbars.com | the scarf bars | 2013-11-04 | 2026-11-04 | 13 | GoDaddy |
| poets-poetry.com | poets poetry | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| homemadegaytubeporn.com | homemade gay tube porn | 2013-08-02 | 2026-08-02 | 13 | Danesco Trading Ltd. |
| concordgroupllc.com | concord group llc | 2013-11-04 | 2026-11-04 | 13 | GoDaddy |
| verzweiflung.com | verzweiflung | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| dogworldbeloit.com | dog world beloit | 2014-02-20 | 2027-02-20 | 13 | GoDaddy |
| hamptonslivetv.com | hamptons live tv | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| wilnz.com | wilnz | 2013-08-01 | 2026-08-01 | 13 | Key-Systems Gmbh |
| insoutherncolorado.com | in southern colorado | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| foreverrestorations.com | forever restorations | 2014-12-05 | 2027-12-05 | 13 | GoDaddy |
| tfqhgs.com | tfqhgs | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| howtogrowup.com | how to grow up | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| arabbitcoins.com | a rabbit coins | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| bjdongzheng.com | bj dong zheng | 2013-08-15 | 2026-08-15 | 13 | Xin Net Technology Corporation |
| ismeetingful.com | is meetingful | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| techniquesbytrish.com | techniques by trish | 2013-11-04 | 2026-11-04 | 13 | GoDaddy |
| wbcell.com | wb cell | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| miabrantley.com | mia brantley | 2013-08-02 | 2026-08-02 | 13 | Launchpad.Com Inc. |
| livredesociete.com | livre de societe | 2013-07-30 | 2026-08-03 | 13 | GoDaddy |
| gdyueyang.com | gd yue yang | 2013-08-12 | 2026-08-12 | 13 | Bizcn.Com, Inc. |
| ashleymasters.com | ashley masters | 2013-11-04 | 2026-11-04 | 13 | GoDaddy |
| indianjewelrymart.com | indian jewelry mart | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| thelpsolution.com | the lp solution | 2014-09-19 | 2027-09-19 | 13 | Amazon Registrar, Inc. |
| cazadoresdeestrellas.com | cazadores de estrellas | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| gentsandsippscocktaillounge.com | gents and sipps cocktail lounge | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| tdxzyyy.com | tdx zyyy | 2013-08-15 | 2026-08-15 | 13 | Xin Net Technology Corporation |
| teentab.com | teen tab | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| xiaofengsc.com | xiao feng sc | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| acivem.com | acivem | 2013-10-10 | 2026-10-10 | 13 | Ovh Sas |
| shfanzhan.com | sh fanzhan | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| daminglu.com | da ming lu | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| cienciasetecnologia.com | ciencias e tecnologia | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| healthybalanceforlife.com | healthy balance for life | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| corfitclubs.com | cor fit clubs | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| 51jiqi.com | 51 ji qi | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| gd2018.com | gd 2018 | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| zssjunhao.com | zss jun hao | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| xtylwsy.com | xtylwsy | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| concreteliberty.com | concrete liberty | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| wavertec.com | waver tec | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| westsceramicsupply.com | wests ceramic supply | 2013-08-01 | 2026-08-01 | 13 | Domain Science Kutatási Szolgáltató Korlátolt Felelősségű Társaság |
| ammodoors.com | ammo doors | 2013-08-05 | 2026-08-05 | 13 | Dynadot |
| besthotelmanagement.com | best hotel management | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| sports-and-law.com | sports and law | 2013-08-01 | 2026-08-01 | 13 | Mesh Digital Limited |
| samdaub.com | sam daub | 2013-08-02 | 2026-08-02 | 13 | Bluehost Inc. |
| sandiegogreenclean.com | san diego green clean | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| skipheller.com | skip heller | 2013-08-04 | 2026-08-04 | 13 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| izkut.com | izkut | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| shazzaq.com | shazzaq | 2016-08-04 | 2029-08-04 | 13 | GoDaddy |
| yhmfl.com | yhmfl | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| thebridgeto.com | the bridge to | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| atwaretech3.com | atware tech 3 | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| aobangshi.com | ao bang shi | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| tylersgordon.com | tylers gordon | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| shuidiaogetou.com | shui diao ge tou | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| yachtmad.com | yacht mad | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| rolls-roycemotorcarsmanila.com | rolls royce motor cars manila | 2013-08-02 | 2026-08-02 | 13 | Launchpad.Com Inc. |
| ts-zh.com | ts zh | 2013-08-07 | 2026-08-07 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| die-laube.com | die laube | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| cygnec.com | cygnec | 2013-08-03 | 2026-08-03 | 13 | Namecheap |
| toyswow.com | toys wow | 2013-08-15 | 2026-08-15 | 13 | Xin Net Technology Corporation |
| streamingfr.com | streaming fr | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| vipbal.com | vip bal | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| nicotinevz.com | nicotine vz | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| vuochnai.com | vuochnai | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| rickycjames.com | ricky c james | 2018-01-18 | 2031-01-18 | 13 | GoDaddy |
| unsworthbrothers.com | unsworth brothers | 2016-08-04 | 2029-08-04 | 13 | GoDaddy |
| louisetaylortherapy.com | louise taylor therapy | 2013-08-03 | 2026-08-03 | 13 | 123-Reg Limited |
| binlearn.com | bin learn | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| tiny-castle.com | tiny castle | 2013-08-02 | 2026-08-02 | 13 | Dreamhost, Llc |
| loveshinestudio.com | love shine studio | 2013-08-02 | 2026-08-02 | 13 | Network Solutions, Llc |
| miaochai.com | miao chai | 2013-08-08 | 2026-08-08 | 13 | 22Net, Inc. |
| familyartpage.com | family art page | 2013-06-07 | 2026-08-03 | 13 | GoDaddy |
| kilotouriste.com | kilo touriste | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| dublinappliancerepair.com | dublin appliance repair | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| stsyy.com | stsyy | 2013-08-07 | 2026-08-07 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| huobakeji.com | huo ba ke ji | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| uncloudedminds.com | unclouded minds | 2013-08-03 | 2026-08-03 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| teknologiinformasi.com | teknologi informasi | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| tropicalthinktank.com | tropical think tank | 2013-08-02 | 2026-08-02 | 13 | Bluehost Inc. |
| qingboms.com | qing bo ms | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| patriciamgagne.com | patricia m gagne | 2013-08-03 | 2026-08-03 | 13 | Wild West Domains, Llc |
| chicagowall.com | chicago wall | 2013-08-03 | 2026-08-03 | 13 | Dreamhost, Llc |
| christinebellerose.com | christine bellerose | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| cosmosloom.com | cosmos loom | 2013-08-05 | 2026-08-05 | 13 | Megazone Corp., Dba Hosting.Kr |
| temperature-logs.com | temperature logs | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| oneeyedsnakes.com | one eyed snakes | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| lister-profile.com | lister profile | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| thedailybobbyjindal.com | the daily bobby jindal | 2013-08-02 | 2026-08-02 | 13 | Moniker Online Services Llc |
| infinityvenues.com | infinity venues | 2013-08-05 | 2026-08-05 | 13 | Cloudflare, Inc. |
| baorentanghk.com | bao ren tang hk | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| rustyallenconstruction.com | rusty allen construction | 2013-09-12 | 2026-09-12 | 13 | GoDaddy |
| xzsey.com | xzsey | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| mandalayauto.com | mandalay auto | 2013-08-05 | 2026-08-05 | 13 | Web Commerce Communications Limited Dba Webnic.Cc |
| healthcorpt.com | health corp t | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| peiupdate.com | pei update | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| theartofcookingfortwo.com | the art of cooking for two | 2014-08-26 | 2027-11-18 | 13 | GoDaddy |
| codycomputers.com | cody computers | 2013-08-02 | 2026-08-02 | 13 | Bluehost Inc. |
| micperrina.com | mic perrina | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| albanesefineart.com | albanese fine art | 2013-11-05 | 2026-11-05 | 13 | GoDaddy |
| yazarkedi.com | yazar kedi | 2013-08-02 | 2026-08-02 | 13 | Register.Com – Network Solutions, Llc |
| lexiangka.com | lexi ang ka | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| hlvbelt.com | hlv belt | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| charitybean.com | charity bean | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| xn--o39av2mepbb5idfo90g.com | xn--o39av2mepbb5idfo90g | 2013-08-06 | 2026-08-06 | 13 | Gabia, Inc. |
| bobsp.com | bobs p | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| adwordsspecialist.com | adwords specialist | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| ecigarettefreetrial.com | e cigarette free trial | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| skinthread.com | skin thread | 2013-08-04 | 2026-08-04 | 13 | Domeneshop As Dba Domainnameshop.Com |
| chumanyi.com | chu man yi | 2013-08-15 | 2026-08-15 | 13 | Xin Net Technology Corporation |
| brittanyfichterwrites.com | brittany fichter writes | 2013-08-03 | 2026-08-03 | 13 | Bluehost Inc. |
| wzjbluosi.com | wz jb luosi | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| crowtracker.com | crow tracker | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| best-bartenders.com | best bartenders | 2013-08-02 | 2026-08-02 | 13 | Bluehost Inc. |
| busybeeaz.com | busy bee az | 2013-11-05 | 2026-11-05 | 13 | GoDaddy |
| yorlifephotography.com | yor life photography | 2013-08-03 | 2026-08-03 | 13 | 123-Reg Limited |
| bicycle-studios.com | bicycle studios | 2013-08-04 | 2026-08-04 | 13 | Dynadot |
| xinbo110.com | xin bo 110 | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| appwid.com | app wid | 2013-08-05 | 2026-08-05 | 13 | Dynadot |
| loveandbemarried.com | love and be married | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| huissiers49.com | huissiers 49 | 2013-11-08 | 2026-11-08 | 13 | Orange |
| hemelhempsteadcleaners.com | hemel hempstead cleaners | 2013-08-01 | 2026-08-01 | 13 | Mesh Digital Limited |
| contrarianstock.com | contrarian stock | 2013-08-05 | 2026-08-05 | 13 | Dynadot |
| cddsfst.com | cddsfst | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| mygovlink.com | my gov link | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| allianceofthequad.com | alliance of the quad | 2013-08-02 | 2026-08-02 | 13 | Register.Com – Network Solutions, Llc |
| appearbycall.com | appear by call | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| zubereiten.com | zubereiten | 2013-09-19 | 2026-09-19 | 13 | Registrygate Gmbh |
| kinedo-douche.com | kinedo douche | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| guysatworkknow.com | guys at work know | 2013-08-03 | 2026-08-03 | 13 | Wild West Domains, Llc |
| mon-association.com | mon association | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| christian-dick.com | christian dick | 2013-08-01 | 2026-08-01 | 13 | United-Domains Gmbh |
| sgzsyy.com | sgzsyy | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| southlakewelding.com | south lake welding | 2013-08-04 | 2026-08-04 | 13 | GoDaddy |
| kilorestaurant.com | kilo restaurant | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| shumeipi.com | shu mei pi | 2013-08-06 | 2026-08-06 | 13 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| doggiedivas.com | doggie divas | 2013-10-21 | 2026-10-21 | 13 | GoDaddy |
| how2assemble.com | how 2 assemble | 2013-11-04 | 2026-11-04 | 13 | GoDaddy |
| meadowlandssuperbowl2014.com | meadowlands super bowl 2014 | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| chrisbmurphy.com | chris b murphy | 2013-09-15 | 2026-09-15 | 13 | GoDaddy |
| cribcollab.com | crib collab | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| nsaguardian.com | nsa guardian | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| wwwdiscountfilters.com | www discount filters | 2013-08-05 | 2026-08-05 | 13 | NameSilo |
| runtai360.com | run tai 360 | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| walzwoodworks.com | walz wood works | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| nsadefender.com | nsa defender | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| halonalukyamuzi.com | halon alukyamuzi | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| rumseyrancheria.com | rumsey rancheria | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| midnitestorm.com | midnite storm | 2013-08-04 | 2026-08-04 | 13 | Turncommerce, Inc. Dba Namebright.Com |
| mymamijia.com | my mami jia | 2013-08-14 | 2026-08-14 | 13 | Gname.Com Pte. Ltd. |
| staffordfirearms.com | stafford firearms | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| sallysedwards.com | sally s edwards | 2013-11-04 | 2026-11-04 | 13 | GoDaddy |
| jxlkbj.com | jxlkbj | 2013-08-13 | 2026-08-13 | 13 | Gname.Com Pte. Ltd. |
| aspoonfulofsugarbakery.com | a spoonful of sugar bakery | 2013-08-02 | 2026-08-02 | 13 | Domain.Com – Network Solutions, Llc |
| northknoxchurch.com | north knox church | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| collegcentral.com | colleg central | 2013-08-03 | 2026-08-03 | 13 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| app2datemydad.com | app 2 date my dad | 2013-08-02 | 2026-08-02 | 13 | Launchpad.Com Inc. |
| boycotcelebs.com | boycot celebs | 2013-08-02 | 2026-08-02 | 13 | Ionos Se |
| savvylok.com | savvy lok | 2013-08-03 | 2026-08-03 | 13 | GoDaddy |
| emersonquietcool.com | emerson quiet cool | 2014-08-11 | 2026-08-11 | 12 | Jiangsu Bangning Science & Technology Co. Ltd. |
| ddinte.com | dd inte | 2014-08-11 | 2026-08-11 | 12 | Jiangsu Bangning Science & Technology Co. Ltd. |
| istanbulfd.com | istanbul fd | 2014-08-02 | 2026-08-02 | 12 | Enom, Llc |
| hotelakar.com | hotel akar | 2014-08-02 | 2026-08-02 | 12 | İSimtescil Bilişim A.Ş. |
| sandyparrish.com | sandy parrish | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| jesusgarbayo.com | jesus garbayo | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| albus-pro.com | albus pro | 2014-08-12 | 2026-08-12 | 12 | Regional Network Information Center, Jsc Dba Ru-Center |
| rjtreasuresil.com | rj treasures il | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| muttsinc.com | mutts inc | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| qukoudai.com | qu koudai | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| beaonlineshopper.com | bea online shopper | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| valuveneers.com | valu veneers | 2014-08-18 | 2026-08-18 | 12 | Ionos Se |
| hasonline.com | has online | 2014-08-02 | 2026-08-02 | 12 | Annulet Llc |
| bernhardtco.com | bernhardt co | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| instant-cashflow.com | instant cashflow | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| trucleancarwash.com | tru clean car wash | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| feltrugpadding.com | felt rug padding | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| greetinglounge.com | greeting lounge | 2014-08-04 | 2026-08-04 | 12 | Dynadot |
| exiangjia.com | e xiang jia | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| ynmmt.com | ynmmt | 2014-08-05 | 2026-08-05 | 12 | Dynadot |
| thehotmessexpress.com | the hot mess express | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| medicalrecordchronology.com | medical record chronology | 2014-08-01 | 2026-08-01 | 12 | Porkbun Llc |
| ineedananalyst.com | i need an analyst | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| monalipatelmd.com | monali patel md | 2014-08-01 | 2026-08-01 | 12 | Name.Com, Inc. |
| taoweiquan.com | tao wei quan | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| eedshdqz.com | eedshdqz | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| servytemglobal.com | servytem global | 2014-08-05 | 2026-08-05 | 12 | Tecnocrática Centro De Datos, S.L. |
| stufflizsays.com | stuff liz says | 2014-08-02 | 2026-08-02 | 12 | Domain.Com – Network Solutions, Llc |
| hrlayer.com | hr layer | 2014-09-13 | 2026-09-13 | 12 | GoDaddy |
| chiigo.com | chiigo | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| transcanadapardonservices.com | trans canada pardon services | 2015-02-04 | 2027-02-04 | 12 | GoDaddy |
| jonathanhorrell.com | jonathan horrell | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| icelandicholiday.com | icelandic holiday | 2014-08-14 | 2026-08-14 | 12 | Abion Ab |
| vendezplusvite.com | vendez plus vite | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| dansconcretecreations.com | dans concrete creations | 2014-08-03 | 2026-08-03 | 12 | Wild West Domains, Llc |
| handrpkt.com | h and r pkt | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| happy-golf.com | happy golf | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| earthfiberlink.com | earth fiber link | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| xdqzby.com | xdqzby | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| worldforequality.com | world for equality | 2014-08-03 | 2026-08-03 | 12 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| heat100radio.com | heat 100 radio | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| aboriginaltourismcanada.com | aboriginal tourism canada | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| eyeovprovidence.com | eyeovprovidence | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| scscglobal.com | scsc global | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| littlerockrelocationguide.com | little rock relocation guide | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| ishenguang.com | i shen guang | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| umcommunity.com | um community | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| prtoners.com | prtoners | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| familyjusticealliance.com | family justice alliance | 2015-02-17 | 2027-02-17 | 12 | GoDaddy |
| dxhwgs.com | dxhwgs | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| rayandersonjr.com | ray anderson jr | 2014-08-02 | 2026-08-02 | 12 | Enom, Llc |
| frillyfelinebeautyspa.com | frilly feline beauty spa | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| kawainuipono-i.com | kawainui pono i | 2014-08-02 | 2026-08-02 | 12 | Domain.Com – Network Solutions, Llc |
| giddyhotels.com | giddy hotels | 2014-08-02 | 2026-08-02 | 12 | Register.Com – Network Solutions, Llc |
| hellisoy.com | hellisoy | 2014-08-03 | 2026-08-03 | 12 | Enom, Llc |
| xn--tteunik-jya.com | xn--tteunik-jya | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| pwardconstruction.com | p ward construction | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| tourismindustriel.com | tourism industriel | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| itsdvine.com | its dvine | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| ines-mendoza.com | ines mendoza | 2014-08-05 | 2026-08-05 | 12 | Cloudflare, Inc. |
| christellemaignan.com | christelle maignan | 2014-08-02 | 2026-08-02 | 12 | Dreamhost, Llc |
| arrestedfelon.com | arrested felon | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| asiabusinessltd.com | asia business ltd | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| 168www.com | 168 www | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| encarra.com | encarra | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| yepaconciergeservices.com | yepa concierge services | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| spicesymphonyny.com | spice symphony ny | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| ixiaoxun.com | i xiao xun | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| thompsonsignshop.com | thompson sign shop | 2015-11-18 | 2027-11-18 | 12 | GoDaddy |
| anniversariobuonamico.com | anniversario buonamico | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| nonkakos.com | nonkakos | 2014-08-14 | 2026-08-14 | 12 | Netearth One Inc. D/B/A Netearth |
| sersholding.com | sers holding | 2014-08-05 | 2026-08-05 | 12 | Web Commerce Communications Limited Dba Webnic.Cc |
| yourpropainter.com | your pro painter | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| taihuajiancai.com | taihuajiancai | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| 312engagementphotography.com | 312 engagement photography | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| mashavasyukova.com | masha vasyukova | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| timmarkwade.com | tim mark wade | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| justtryitworks.com | just try it works | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| yilinna.com | yi lin na | 2014-08-07 | 2026-08-07 | 12 | 22Net, Inc. |
| rottensoftware.com | rotten software | 2014-08-04 | 2026-08-04 | 12 | Netart Registrar Sp. Z O.O. |
| kpminvestmentsgroup.com | kpm investments group | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| noahhazel.com | noah hazel | 2014-09-16 | 2026-09-16 | 12 | Vautron Rechenzentrum Ag |
| protein-and-cell.com | protein and cell | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| institut-leon-lesaffre.com | institut leon lesaffre | 2014-09-15 | 2026-09-15 | 12 | Nameshield Sas |
| snugdreams.com | snug dreams | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| mdbprojects.com | mdb projects | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| myinspiredsign.com | my inspired sign | 2015-04-07 | 2027-04-07 | 12 | GoDaddy |
| mrscarruthers.com | mrs carruthers | 2014-08-02 | 2026-08-02 | 12 | Register.Com – Network Solutions, Llc |
| xn--tte-unik-k1a.com | xn--tte-unik-k1a | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| roberttaraschi.com | robert taraschi | 2014-08-02 | 2026-08-02 | 12 | Domain.Com – Network Solutions, Llc |
| fundamentalstraining.com | fundamentals training | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| hancoagricultural.com | hanco agricultural | 2014-08-03 | 2026-08-03 | 12 | 123-Reg Limited |
| ctseniorhelp.com | ct senior help | 2014-11-05 | 2026-11-05 | 12 | GoDaddy |
| xunhelaw.com | xun he law | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| bestcataractdoctororlando.com | best cataract doctor orlando | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| flexrod.com | flex rod | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| adventurewagons.com | adventure wagons | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| 513game.com | 513 game | 2014-08-07 | 2026-08-07 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| icatalogic.com | i catalogic | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| scottrends.com | scot trends | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| xuzepeixun.com | xu ze peixun | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| hzxgjx.com | hzxgjx | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| daniandjordis.com | dani and jordis | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| agilegantt.com | agile gantt | 2014-08-14 | 2026-08-14 | 12 | Abion Ab |
| prgcycle.com | prg cycle | 2014-08-03 | 2026-08-03 | 12 | Enom, Llc |
| ladybitstoiletries.com | lady bits toiletries | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| fadonggroup.com | fa dong group | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| expertconstruction1.com | expert construction 1 | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| iwan3.com | iwan 3 | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| btmx1.com | btmx 1 | 2014-08-15 | 2026-08-15 | 12 | Xin Net Technology Corporation |
| laderivadelasombra.com | la deriva de la sombra | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| xn--j7qs1k11g8nk9k4a.com | xn--j7qs1k11g8nk9k4a | 2014-08-03 | 2026-08-03 | 12 | Xiamen 35.Com Information Co., Ltd. |
| juliamhoffman.com | juliam hoffman | 2014-08-02 | 2026-08-02 | 12 | Register.Com – Network Solutions, Llc |
| almutla.com | al mutla | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| ebolaalerts.com | ebola alerts | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| xxanan.com | xxanan | 2014-08-03 | 2026-08-03 | 12 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| bestlasercataractsurgeonorlando.com | best laser cataract surgeon orlando | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| chinese-tuliao.com | chinese tuliao | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| shlywh.com | shlywh | 2014-08-14 | 2026-08-14 | 12 | Hefei Juming Network Technology Co., Ltd |
| xn--u8jc8kza.com | xn--u8jc8kza | 2014-08-04 | 2026-08-04 | 12 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| hbbaotian.com | hb baotian | 2014-08-14 | 2026-08-14 | 12 | July Name Limited |
| xray-soft.com | xray soft | 2014-08-05 | 2026-08-05 | 12 | Onlinenic, Inc. |
| helpuninstaller.com | help uninstaller | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| leaguegag.com | league gag | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| pumptrakkxpoints.com | pump trakk x points | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| dundeearms.com | dundee arms | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| degrassisaviors.com | degrassi saviors | 2014-08-02 | 2026-08-02 | 12 | Register.Com – Network Solutions, Llc |
| rookmelderwinkel.com | rookmelder winkel | 2014-09-16 | 2026-09-16 | 12 | Key-Systems Gmbh |
| yueya-trading.com | yue ya trading | 2014-08-01 | 2026-08-01 | 12 | Chengdu West Dimension Digital Technology Co., Ltd. |
| bacindaday.com | bacinda day | 2014-09-13 | 2026-09-13 | 12 | 123-Reg Limited |
| thebeautyandthewhore.com | the beauty and the whore | 2014-08-03 | 2026-08-03 | 12 | Wild West Domains, Llc |
| myviewthroughrosecoloredglasses.com | my view through rose colored glasses | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| iberiahost.com | iberia host | 2014-08-03 | 2026-08-03 | 12 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| sistemi-massicci.com | sistemi massicci | 2014-08-12 | 2026-08-12 | 12 | Register Spa |
| rakezbusinessexcellenceawards.com | rakez business excellence awards | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| valubanding.com | valu banding | 2014-08-18 | 2026-08-18 | 12 | Ionos Se |
| entgrat-forum.com | entgrat forum | 2014-10-02 | 2026-10-02 | 12 | Hetzner Online Gmbh |
| cleangreengadgets.com | clean green gadgets | 2014-09-15 | 2026-09-15 | 12 | Metaregistrar Bv |
| adesignspark.com | a design spark | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| glowholisticnutrition.com | glow holistic nutrition | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| zsdeya.com | zs deya | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| rollout365.com | rollout 365 | 2014-08-02 | 2026-08-02 | 12 | Enom, Llc |
| 365mahjong.com | 365 mahjong | 2014-08-21 | 2026-08-21 | 12 | Safenames Ltd. |
| tradelaketitle.com | trade lake title | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| vincevora.com | vince vora | 2014-08-03 | 2026-08-03 | 12 | Domain.Com – Network Solutions, Llc |
| ashariahome.com | asharia home | 2014-08-05 | 2026-08-05 | 12 | Gransy, S.R.O. |
| bitcointaxlaws.com | bitcoin tax laws | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| garagethaon.com | garage thaon | 2014-10-24 | 2026-10-24 | 12 | Orange |
| jsdshow.com | jsd show | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| aging-care-power-of-attorney.com | aging care power of attorney | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| brucereidmusic.com | bruce reid music | 2014-09-09 | 2026-09-09 | 12 | 123-Reg Limited |
| b2b-ecommerce-solutions.com | b2b ecommerce solutions | 2014-08-01 | 2026-08-01 | 12 | Mesh Digital Limited |
| ninebeforenine.com | nine before nine | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| sienjiaoyu.com | sien jiaoyu | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| cameronparaoregon.com | cameron para oregon | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| gd-yk.com | gd yk | 2014-07-31 | 2026-07-31 | 12 | Chengdu West Dimension Digital Technology Co., Ltd. |
| haveyou-eaten.com | have you eaten | 2014-08-03 | 2026-08-03 | 12 | Wild West Domains, Llc |
| jackandevedesign.com | jack and eve design | 2014-08-02 | 2026-08-02 | 12 | Blacknight Internet Solutions Ltd. |
| cksclinic.com | cks clinic | 2014-08-11 | 2026-08-11 | 12 | Regional Network Information Center, Jsc Dba Ru-Center |
| bnb-grabs.com | bnb grabs | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| gzanple.com | gz anple | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| religiondictionary.com | religion dictionary | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| chellissimaphotography.com | chellissima photography | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| alianzaapostolica.com | alianza apostolica | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| kaiweibao.com | kai wei bao | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| noclientsinc.com | no clients inc | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| az-solution.com | az solution | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| xingwangbj.com | xing wang bj | 2014-08-15 | 2026-08-15 | 12 | Xin Net Technology Corporation |
| carmeldesigninc.com | carmel design inc | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| cibgendainiteroi.com | cibg endai niteroi | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| rcnct.com | rcnct | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| rawwoodtomusicfilm.com | raw wood to music film | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| jxhxxb.com | jxhxxb | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| peacefultv.com | peaceful tv | 2014-08-02 | 2026-08-02 | 12 | Bluehost Inc. |
| feltpadreviews.com | felt pad reviews | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| thetaxandaccountingpros.com | the tax and accounting pros | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| txhacker.com | tx hacker | 2014-08-05 | 2026-08-05 | 12 | Cloudflare, Inc. |
| miriamkinunda.com | miriam kinunda | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| jerrytalkington.com | jerry talkington | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| building-concrete.com | building concrete | 2014-08-12 | 2026-08-12 | 12 | Register Spa |
| accessctplans.com | access ct plans | 2014-11-05 | 2026-11-05 | 12 | GoDaddy |
| joymadefood.com | joy made food | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| rememberators.com | rememberators | 2014-08-03 | 2026-08-03 | 12 | 123-Reg Limited |
| flagpurse.com | flag purse | 2014-08-03 | 2026-08-03 | 12 | 123-Reg Limited |
| hxjdzc.com | hxjdzc | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| designfluential.com | design fluential | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| bouvetpartners.com | bouvet partners | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| attallapharmacy.com | attalla pharmacy | 2014-08-20 | 2026-08-20 | 12 | Amazon Registrar, Inc. |
| kevincameronparaoregon.com | kevin cameron para oregon | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| hotpixelproductions.com | hot pixel productions | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| techspectrics.com | tech spectrics | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| kammz.com | kammz | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| qqb8.com | qqb 8 | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| fumpandmannys.com | fump and mannys | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| emmettscanlanfans.com | emmett scanlan fans | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| taghdisherb.com | taghdis herb | 2014-08-05 | 2026-08-05 | 12 | Web Commerce Communications Limited Dba Webnic.Cc |
| busanonna.com | busa nonna | 2014-08-06 | 2026-08-06 | 12 | Gabia, Inc. |
| mempreserved.com | mem preserved | 2014-08-02 | 2026-08-02 | 12 | Domain.Com – Network Solutions, Llc |
| uwayu.com | uwayu | 2014-08-08 | 2026-08-08 | 12 | Cv. Jogjacamp |
| obeim.com | obeim | 2014-08-13 | 2026-08-13 | 12 | Hefei Juming Network Technology Co., Ltd |
| silaninseferi.com | silanin seferi | 2014-08-02 | 2026-08-02 | 12 | İSimtescil Bilişim A.Ş. |
| sanantoniotexasemployment.com | san antonio texas employment | 2014-08-02 | 2026-08-02 | 12 | Epik Llc |
| lifeinonedrop.com | life in one drop | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| readymadecurtain.com | ready made curtain | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| jiajihua.com | jia ji hua | 2014-08-15 | 2026-08-15 | 12 | Xin Net Technology Corporation |
| mop321.com | mop 321 | 2014-08-02 | 2026-08-02 | 12 | 1Api Gmbh |
| tzulaii.com | tzulaii | 2014-08-05 | 2026-08-05 | 12 | Web Commerce Communications Limited Dba Webnic.Cc |
| kccc-credit.com | kccc credit | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| happydroppers.com | happy droppers | 2014-08-02 | 2026-08-02 | 12 | Register.Com – Network Solutions, Llc |
| tercumanemlak.com | tercuman emlak | 2014-08-05 | 2026-08-05 | 12 | Onlinenic, Inc. |
| affinbankgroup.com | affin bank group | 2014-11-05 | 2026-11-05 | 12 | Wild West Domains, Llc |
| 03mgm.com | 03 mgm | 2014-08-04 | 2026-08-04 | 12 | NameSilo |
| bluehorselifecoaching.com | blue horse life coaching | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| jtalkington.com | j talkington | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| robot3000.com | robot 3000 | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| cityservechattanooga.com | city serve chattanooga | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| airnowrental.com | air now rental | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| accerola.com | accerola | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| missadventurestheb-log.com | miss adventures the b log | 2014-08-02 | 2026-08-02 | 12 | Enom, Llc |
| mcadesigns.com | mca designs | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| solesuppport.com | sole suppport | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| bestcataractsurgeonorlando.com | best cataract surgeon orlando | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| snowforceplowing.com | snow force plowing | 2014-09-13 | 2026-09-13 | 12 | GoDaddy |
| peterremshwiller.com | peter remshwiller | 2014-08-03 | 2026-08-03 | 12 | Bluehost Inc. |
| barbecue-grill.com | barbecue grill | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| amychastainphotography.com | amy chastain photography | 2014-08-02 | 2026-08-02 | 12 | Bluehost Inc. |
| servicepardontranscanada.com | service pardon trans canada | 2015-02-04 | 2027-02-04 | 12 | GoDaddy |
| xxydj.com | xxydj | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| radicalchicscarves.com | radical chic scarves | 2014-08-06 | 2026-08-06 | 12 | Registrar Of Domain Names Reg.Ru Llc |
| kcphil.com | kc phil | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| menendezonline.com | menendez online | 2014-08-02 | 2026-08-02 | 12 | Bluehost Inc. |
| vaillanti.com | vaillanti | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| sordik.com | sordik | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| hngx99.com | hngx 99 | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| cocktailsandcigars.com | cocktails and cigars | 2014-08-02 | 2026-08-02 | 12 | Launchpad.Com Inc. |
| talegaonproperty.com | talegaon property | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| usutatami.com | usu tatami | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| rvadogblog.com | rva dog blog | 2014-08-02 | 2026-08-02 | 12 | Bluehost Inc. |
| cnzhaoding.com | cn zhao ding | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| popshopparadise.com | pop shop paradise | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| scnelsonlaw.com | sc nelson law | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| baankinaree.com | baan kinaree | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| marleyparker.com | marley parker | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| frozenlighttheater.com | frozen light theater | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| jyyongguang.com | jy yong guang | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| amakinbot.com | amakin bot | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| venturabeverage.com | ventura beverage | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| dongxs.com | dong xs | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| parkstreethalloween.com | park street halloween | 2014-08-01 | 2026-08-01 | 12 | Name106, Inc. |
| mapleridgehealthcareproducts.com | maple ridge healthcare products | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| composerforvisualmedia.com | composer for visual media | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| worldfiberlink.com | world fiber link | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| testscoring-online.com | test scoring online | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| enilanerda.com | enilanerda | 2014-08-01 | 2026-08-01 | 12 | Mesh Digital Limited |
| watchingabroad.com | watching abroad | 2014-08-02 | 2026-08-02 | 12 | Key-Systems Gmbh |
| cabinontheblue.com | cabin on the blue | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| elochkin.com | elochkin | 2014-08-11 | 2026-08-11 | 12 | Regional Network Information Center, Jsc Dba Ru-Center |
| tierrafoundation.com | tierra foundation | 2016-08-04 | 2028-08-03 | 12 | GoDaddy |
| americanapplebrandy.com | american apple brandy | 2014-08-05 | 2026-08-05 | 12 | Cloudflare, Inc. |
| allafiera.com | alla fiera | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| tvastoria.com | tv astoria | 2015-04-23 | 2027-04-23 | 12 | GoDaddy |
| akoto-bamfo.com | akoto bamfo | 2014-08-01 | 2026-08-01 | 12 | Name.Com, Inc. |
| xpressionsbydamaris.com | xpressions by damaris | 2014-11-04 | 2026-11-04 | 12 | Wild West Domains, Llc |
| projectperformancehq.com | project performance hq | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| hnkcm.com | hnkcm | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| fleetwoodmacsongs.com | fleetwood mac songs | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| newportforeclosureprevention.com | newport foreclosure prevention | 2014-08-01 | 2026-08-01 | 12 | Name106, Inc. |
| eugenepetersondesign.com | eugene peterson design | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| kaiamdesigns.com | kaiam designs | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| technicallygeli.com | technically geli | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| glron.com | glron | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| airzuche.com | air zuche | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| huntcbus.com | hunt cbus | 2014-08-02 | 2026-08-02 | 12 | Bluehost Inc. |
| monilove.com | moni love | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| yongquandj.com | yong quan dj | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| newhomesinwendell.com | new homes in wendell | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| safety2017singapore.com | safety 2017 singapore | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| bestcataractdoctor.com | best cataract doctor | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| holidaywishestoycastle.com | holiday wishes toy castle | 2014-09-11 | 2026-09-11 | 12 | Wild West Domains, Llc |
| miri-car-rental.com | miri car rental | 2014-08-05 | 2026-08-05 | 12 | Web Commerce Communications Limited Dba Webnic.Cc |
| anatlantachristmas.com | an atlanta christmas | 2014-08-03 | 2026-08-03 | 12 | Domain.Com – Network Solutions, Llc |
| painlessprincess.com | painless princess | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| nerimagreen.com | nerima green | 2014-08-03 | 2026-08-03 | 12 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| zenmagicpublishing.com | zen magic publishing | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| victoralfonsosuarezmuratorio.com | victor alfonso suarez muratorio | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| warba-usa.com | warba usa | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| 1hourbefore.com | 1 hour before | 2015-06-19 | 2027-06-19 | 12 | Gandi Sas |
| ct-week.com | ct week | 2014-09-18 | 2026-09-18 | 12 | Csc Corporate Domains, Inc. |
| xcdhg.com | xcdhg | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| yxnow.com | yx now | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| vertex3dprinter.com | vertex 3d printer | 2014-08-05 | 2026-08-05 | 12 | Eurodns S.A. |
| carolynfoxart.com | carolyn fox art | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| ctretireefun.com | ct retiree fun | 2014-11-05 | 2026-11-05 | 12 | GoDaddy |
| beansprouts-haba.com | bean sprouts haba | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| whereyoulivethemovie.com | where you live the movie | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| xinxingyue.com | xin xing yue | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| goldfingerrings.com | gold finger rings | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| thachcaobacninh.com | thach cao bac ninh | 2014-08-04 | 2026-08-04 | 12 | NameSilo |
| elsl999.com | elsl 999 | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| bestlasiksurgeonorlando.com | best lasik surgeon orlando | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| robertmasonstudio.com | robert mason studio | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| fuhito-design.com | fuhito design | 2014-08-03 | 2026-08-03 | 12 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| miamistringrentals.com | miami string rentals | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| xie800.com | xie 800 | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| buddydeshler.com | buddy deshler | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| deburring-forum.com | deburring forum | 2014-10-02 | 2026-10-02 | 12 | Hetzner Online Gmbh |
| wlmqbb.com | wlmq bb | 2014-08-13 | 2026-08-13 | 12 | Hefei Juming Network Technology Co., Ltd |
| mybirthingstories.com | my birthing stories | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| haro-1995.com | haro 1995 | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| fineart-production.com | fine art production | 2014-08-05 | 2026-08-05 | 12 | Net-Chinese Co., Ltd. |
| fizzexx.com | fizzexx | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| qdzsth.com | qdzsth | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| gnome-bombsquad.com | gnome bomb squad | 2014-08-03 | 2026-08-03 | 12 | Dreamhost, Llc |
| paddydoylefarrier.com | paddy doyle farrier | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| zpzsyl.com | zpzsyl | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| testauswertung.com | test auswertung | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| xalanqiao.com | xa lan qiao | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| water-worn.com | water worn | 2014-08-20 | 2026-08-20 | 12 | Safenames Ltd. |
| madeleinebamfielddillon.com | madeleine bamfield dillon | 2014-08-03 | 2026-08-03 | 12 | 123-Reg Limited |
| contrataciondeconferencistas.com | contratacion de conferencistas | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| lyghuadu.com | lyg huadu | 2014-08-15 | 2026-08-15 | 12 | Xiamen Chinasource Internet Service Co., Ltd |
| cckdefense.com | cck defense | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| centralislipplaza.com | central islip plaza | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| xibanji.com | xi ban ji | 2014-08-07 | 2026-08-07 | 12 | 22Net, Inc. |
| phillawyer.com | phil lawyer | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| yasasiitoki.com | yasasii toki | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| ahxiaodian.com | ah xiao dian | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| lifeinanoildrop.com | life in an oil drop | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| cskblooms.com | csk blooms | 2016-04-19 | 2028-04-19 | 12 | GoDaddy |
| shanlishan.com | shan li shan | 2014-08-15 | 2026-08-15 | 12 | Xin Net Technology Corporation |
| maendier.com | maendier | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| moniquesymone.com | monique symone | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| belugabetting.com | beluga betting | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| digitaldt.com | digital dt | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| twiddlizer.com | twiddlizer | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| athomewithowen.com | at home with owen | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| adhostel.com | ad hostel | 2014-08-02 | 2026-08-02 | 12 | Domain.Com – Network Solutions, Llc |
| scorpionmed.com | scorpion med | 2015-02-01 | 2027-02-01 | 12 | GoDaddy |
| truvisionmall.com | tru vision mall | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| justinsongwriter.com | justin songwriter | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| projectcommandcentre.com | project command centre | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| baoxinzd.com | bao xin zd | 2014-08-13 | 2026-08-13 | 12 | July Name Limited |
| 997272.com | 997272 | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| terzaak.com | terzaak | 2014-08-05 | 2026-08-05 | 12 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| imraannagdee.com | imraan nagdee | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| innovatesussex.com | innovate sussex | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| therapists-in-toronto.com | therapists in toronto | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| poweringtheone.com | powering the one | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| four20mart.com | four 20 mart | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| genrehair.com | genre hair | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| chivasmiller.com | chivas miller | 2014-08-03 | 2026-08-03 | 12 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| contrataciondeconductores.com | contratacion de conductores | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| iamejaythedj.com | i am ejay the dj | 2014-09-13 | 2026-09-13 | 12 | GoDaddy |
| hancofeedbins.com | hanco feed bins | 2014-08-03 | 2026-08-03 | 12 | 123-Reg Limited |
| yzxsyyk.com | yzxsyyk | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| emergencyreliefkits.com | emergency relief kits | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| protein-cell.com | protein cell | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| taborentertainment.com | tabor entertainment | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| tasprofilescanner.com | tas profile scanner | 2014-08-02 | 2026-08-02 | 12 | Domain.Com – Network Solutions, Llc |
| amydyerconsulting.com | amy dyer consulting | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| lonestarlc.com | lone star lc | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| egeuwr.com | egeuwr | 2014-08-02 | 2026-08-02 | 12 | İSimtescil Bilişim A.Ş. |
| annebonneythelastpirate.com | anne bonney the last pirate | 2014-11-05 | 2026-11-05 | 12 | GoDaddy |
| bramiss.com | bramiss | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| drsarawine.com | dr sara wine | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| brsdws.com | brsdws | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| gabsales.com | gab sales | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| guardmypc.com | guard my pc | 2014-08-04 | 2026-08-04 | 12 | Dynadot |
| bmpension.com | bm pension | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| intelbuy.com | intel buy | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| urbankompas.com | urban kompas | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| annaswebart.com | annas web art | 2014-08-04 | 2026-08-04 | 12 | Namebake Llc |
| thermal-imaging-sydney.com | thermal imaging sydney | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| tgszxxx.com | tgszxxx | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| xmlgfcyy.com | xmlgfcyy | 2014-08-15 | 2026-08-15 | 12 | Xin Net Technology Corporation |
| jeffersonestate.com | jefferson estate | 2014-08-01 | 2026-08-01 | 12 | Domain Science Kutatási Szolgáltató Korlátolt Felelősségű Társaság |
| hempplywood.com | hemp plywood | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| rurallandtexas.com | rural land texas | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| kmrmultiservicios.com | kmr multiservicios | 2014-08-05 | 2026-08-05 | 12 | Dinahosting S.L. |
| yuerbaike.com | yuer baike | 2014-08-07 | 2026-08-07 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| olympicdreamsrecords.com | olympic dreams records | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| theespadin.com | the espadin | 2014-08-02 | 2026-08-02 | 12 | Domain.Com – Network Solutions, Llc |
| yourarse.com | your arse | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| b2c2014.com | b2c 2014 | 2014-08-04 | 2026-08-04 | 12 | NameSilo |
| robertaguzzardi.com | roberta guzzardi | 2014-08-03 | 2026-08-03 | 12 | Wild West Domains, Llc |
| littlerockarkansasrelocationguide.com | little rock arkansas relocation guide | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| greekky.com | greek ky | 2014-08-06 | 2026-08-06 | 12 | Registrar Of Domain Names Reg.Ru Llc |
| developinggurus.com | developing gurus | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| valupanels.com | valu panels | 2014-08-18 | 2026-08-18 | 12 | Ionos Se |
| evergreenslumber.com | evergreen slumber | 2016-09-06 | 2028-09-06 | 12 | GoDaddy |
| rethink-platform.com | rethink platform | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| musiceyeq.com | music eye q | 2014-08-03 | 2026-08-03 | 12 | Enom, Llc |
| shakkinhensaishitai.com | shakkin hensai shitai | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| fengshuiresearch.com | feng shui research | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| nookkar.com | nook kar | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| raybaccari.com | ray baccari | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| sprintsventures.com | sprints ventures | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| kaloklitattoo.com | kalokli tattoo | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| maugogo.com | mau gogo | 2014-09-16 | 2026-09-16 | 12 | Key-Systems Gmbh |
| zjgyhd.com | zjgyhd | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| senzjoy.com | senz joy | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| ysshlxs.com | ysshlxs | 2014-08-13 | 2026-08-13 | 12 | Shanghai Meicheng Technology Information Development Co., Ltd. |
| autovollverklebung.com | auto voll verklebung | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| hicksfilm.com | hicks film | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| techieio.com | techie io | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| careerreinventionbook.com | career reinvention book | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| bieyunyoga.com | bie yun yoga | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| rakftzbusinessexcellenceawards.com | rak ftz business excellence awards | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| 960sukisuki.com | 960 suki suki | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| pmcomcen.com | pm com cen | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| indiefilminvest.com | indie film invest | 2014-08-04 | 2026-08-04 | 12 | Dropcatch.Com 427 Llc |
| leclercqfamily.com | leclercq family | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| karatecontact.com | karate contact | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| schetavbanke.com | scheta v banke | 2014-08-06 | 2026-08-06 | 12 | Registrar Of Domain Names Reg.Ru Llc |
| edodirectory.com | edo directory | 2014-09-10 | 2026-08-03 | 12 | GoDaddy |
| saludyestarbien.com | salud y estar bien | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| whsbv.com | whsbv | 2015-08-21 | 2027-08-21 | 12 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| payzzion.com | payzzion | 2014-08-10 | 2026-08-10 | 12 | Regional Network Information Center, Jsc Dba Ru-Center |
| cincihomefinder.com | cinci home finder | 2014-02-12 | 2026-08-03 | 12 | GoDaddy |
| wdhs88.com | wdhs 88 | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| stella-okinawa.com | stella okinawa | 2014-08-03 | 2026-08-03 | 12 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| sakge.com | sakge | 2014-08-03 | 2026-08-03 | 12 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| szaidilong.com | szaidilong | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| hirugaowife.com | hirugao wife | 2014-08-03 | 2026-08-03 | 12 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| networthydomains.com | net worthy domains | 2014-08-05 | 2026-08-05 | 12 | Onlinenic, Inc. |
| rivtakllc.com | rivtak llc | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| clsui.com | clsui | 2014-08-03 | 2026-08-03 | 12 | Wild West Domains, Llc |
| takamitsunii.com | takamitsunii | 2014-08-03 | 2026-08-03 | 12 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| channelislandsbrewing.com | channel islands brewing | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| dinmamaidservices.com | din ma maid services | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| worldhorsestables.com | world horse stables | 2015-08-21 | 2027-08-21 | 12 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| haminit.com | ham init | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| greatprice247.com | great price 247 | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| fabulistconnection.com | fabulist connection | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| sxckym.com | sxckym | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| woncheng56.com | won cheng 56 | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| jansoftsystems.com | jan soft systems | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| the30dayhelper.com | the 30 day helper | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| jz2022.com | jz 2022 | 2014-08-15 | 2026-08-15 | 12 | Xin Net Technology Corporation |
| kpkitchenremodeling.com | kp kitchen remodeling | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| lost-entry.com | lost entry | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| footgolfnewmexico.com | foot golf new mexico | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| goyalpariwar.com | goyal pariwar | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| daikiudon.com | daiki udon | 2014-08-02 | 2026-08-02 | 12 | Xserver, Inc. |
| sasarahosara.com | sasara hosara | 2014-09-05 | 2026-09-05 | 12 | Japan Registry Services Co., Ltd. |
| saclarimiseviyorum.com | saclarimi seviyorum | 2014-09-15 | 2026-09-15 | 12 | Nameshield Sas |
| cnictv.com | cnic tv | 2014-08-13 | 2026-08-13 | 12 | Shanghai Meicheng Technology Information Development Co., Ltd. |
| designbyemulsion.com | design by emulsion | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| gljdata.com | glj data | 2014-08-01 | 2026-08-01 | 12 | Name106, Inc. |
| xzxfw.com | xzxfw | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| ameristudent.com | ameri student | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| buzzezlapub.com | buzzez la pub | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| newyorklufe.com | new york lufe | 2014-08-01 | 2026-08-01 | 12 | Chengdu West Dimension Digital Technology Co., Ltd. |
| dawnwilsonmillinery.com | dawn wilson millinery | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| autobotpartners.com | autobot partners | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| wangaofa.com | wang ao fa | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| edwalk.com | ed walk | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| unbrandedonline.com | unbranded online | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| lifeineachdrop.com | life in each drop | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| mcclurewebb.com | mcclure webb | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| myportuguesegen.com | my portuguese gen | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| taraacie.com | tara acie | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| btsotomotiv.com | bts otomotiv | 2014-08-05 | 2026-08-05 | 12 | Ihs Telekom, Inc. |
| jinyu-sh.com | jinyu sh | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| goldkaufpro.com | gold kauf pro | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| ljayzh.com | ljayzh | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| teaeu.com | tea eu | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| muddubuddu.com | muddu buddu | 2014-08-03 | 2026-08-03 | 12 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| weighingdevices.com | weighing devices | 2014-08-03 | 2026-08-03 | 12 | Spaceship, Inc. |
| mycityweekend.com | my city weekend | 2014-08-14 | 2026-08-14 | 12 | Abion Ab |
| socialwhirl2.com | social whirl 2 | 2014-08-02 | 2026-08-02 | 12 | Register.Com – Network Solutions, Llc |
| oxlegacy.com | ox legacy | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| hatml.com | hatml | 2014-08-06 | 2026-08-06 | 12 | Global Domains International, Inc. Dba Domaincostclub.Com |
| ccomin.com | ccomin | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| vittoriozuninocelotto.com | vittorio zunino celotto | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| ichamei.com | ichamei | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| texarondack.com | tex arondack | 2015-03-20 | 2027-03-20 | 12 | GoDaddy |
| suguniokanetsukuru.com | suguni okane tsukuru | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| mycloudsurvey.com | my cloud survey | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| fintechbenelux.com | fintech benelux | 2014-09-15 | 2026-09-15 | 12 | Metaregistrar Bv |
| xn--yfry1zx4k42j.com | xn--yfry1zx4k42j | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| stoneyemshwiller.com | stoney emshwiller | 2014-08-03 | 2026-08-03 | 12 | Bluehost Inc. |
| heatherlongdesign.com | heather long design | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| szlysb.com | szlysb | 2014-08-04 | 2026-08-04 | 12 | NameSilo |
| 7boo.com | 7 boo | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| nempsu.com | nempsu | 2014-08-03 | 2026-08-03 | 12 | Wild West Domains, Llc |
| valleyda.com | valley da | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| tescharlotte.com | tes charlotte | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| envisioncreatives.com | envision creatives | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| presthocate.com | presthocate | 2014-08-04 | 2026-08-04 | 12 | Dynadot |
| drchrilynleehealthshow.com | dr chrilyn lee health show | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| qihegangmao.com | qihe gangmao | 2014-08-13 | 2026-08-13 | 12 | Shanghai Meicheng Technology Information Development Co., Ltd. |
| longnk.com | long nk | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| newsmileconsultation.com | new smile consultation | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| genkaijapanese.com | genkai japanese | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| hashfate.com | hash fate | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| shewrysaldanalaw.com | shewry saldana law | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| yepacs.com | yepacs | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| cosmostalkradio.com | cosmos talk radio | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| 5x7fit.com | 5×7 fit | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| waynebarni.com | wayne barni | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| prodigyjamtracks.com | prodigy jam tracks | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| mlfryman.com | ml fryman | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| 420clubshop.com | 420 club shop | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| ajmerhyundai.com | ajmer hyundai | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| trustmyopinion.com | trust my opinion | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| ctretireehelp.com | ct retiree help | 2014-11-05 | 2026-11-05 | 12 | GoDaddy |
| zzxydj.com | zzxydj | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| rayatele.com | raya tele | 2014-08-02 | 2026-08-02 | 12 | 1Api Gmbh |
| immomarktplatz.com | immo marktplatz | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| 3hpec.com | 3hpec | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| blingcover.com | bling cover | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| alloywheel4u.com | alloy wheel 4u | 2014-08-07 | 2026-08-07 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| mileshopper.com | mile shopper | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| tuke365.com | tuke 365 | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| torontomodernrentals.com | toronto modern rentals | 2015-03-08 | 2027-03-08 | 12 | GoDaddy |
| blakesheltonsongs.com | blake shelton songs | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| 30dayhelper.com | 30 day helper | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| m-mi.com | m mi | 2014-08-14 | 2026-08-14 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| agentsofnerd.com | agents of nerd | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| labelleetlapute.com | la belle et la pute | 2014-08-03 | 2026-08-03 | 12 | Wild West Domains, Llc |
| snszfgjj.com | snszfgjj | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| bhmlawyer.com | bhm lawyer | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| logoelastic.com | logo elastic | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| airstream-aircons.com | airstream aircons | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| professorprotools.com | professor pro tools | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| szqwl.com | szqwl | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| vitesseexchange.com | vitesse exchange | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| nootropiccenter.com | nootropic center | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| hunt614.com | hunt 614 | 2014-08-02 | 2026-08-02 | 12 | Bluehost Inc. |
| sandrashun.com | sandra shun | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| labellaylaputa.com | la bella y la puta | 2014-08-03 | 2026-08-03 | 12 | Wild West Domains, Llc |
| valuveneer.com | valu veneer | 2014-08-18 | 2026-08-18 | 12 | Ionos Se |
| auroratristan.com | aurora tristan | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| ymwygl.com | ymwygl | 2014-08-13 | 2026-08-13 | 12 | Shanghai Meicheng Technology Information Development Co., Ltd. |
| emaimang.com | e maimang | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| quancome.com | quan come | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| 1919999.com | 1919999 | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| 30dayhelp.com | 30 day help | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| rugpadsoverhardwood.com | rug pads over hardwood | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| sacredsensualtouch.com | sacred sensual touch | 2014-08-03 | 2026-08-03 | 12 | Dreamhost, Llc |
| yanyigonghui.com | yan yi gong hui | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| lphshop.com | lph shop | 2014-08-01 | 2026-08-01 | 12 | Chengdu West Dimension Digital Technology Co., Ltd. |
| ineedarealestateanalyst.com | i need a real estate analyst | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| catherinemonica.com | catherine monica | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| silkefocken.com | silke focken | 2014-08-01 | 2026-08-01 | 12 | Mesh Digital Limited |
| valuband.com | valu band | 2014-08-18 | 2026-08-18 | 12 | Ionos Se |
| my-pydio.com | my pydio | 2014-08-02 | 2026-08-02 | 12 | Enom, Llc |
| danslaville.com | dans la ville | 2014-08-05 | 2026-08-05 | 12 | Namebay Sam |
| songenxi.com | song en xi | 2014-08-08 | 2026-08-08 | 12 | 22Net, Inc. |
| sporeburst.com | spore burst | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| eyermangroup.com | eyerman group | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| xyanan.com | xy anan | 2014-08-03 | 2026-08-03 | 12 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| visitbanten.com | visit banten | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| jewelrytatts.com | jewelry tatts | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| chaneycieck.com | chaney cieck | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| legendarytnt.com | legendary tnt | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| wtaoli.com | w tao li | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| yuefengmeizhuang.com | yue feng mei zhuang | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| nidderdalecpl.com | nidderdale cpl | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| dottorjager.com | dottor jager | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| xiayuwei.com | xia yu wei | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| rugpadsforhardwood.com | rug pads for hardwood | 2014-08-05 | 2026-08-05 | 12 | NameSilo |
| middleeastoutlookmag.com | middle east outlook mag | 2014-08-03 | 2026-08-03 | 12 | 123-Reg Limited |
| glennshirk.com | glenn shirk | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| kirgu-mtv.com | kirgu mtv | 2014-08-11 | 2026-08-11 | 12 | Regional Network Information Center, Jsc Dba Ru-Center |
| txticketlaw.com | tx ticket law | 2014-08-02 | 2026-08-02 | 12 | Register.Com – Network Solutions, Llc |
| gzgcsy.com | gzgcsy | 2014-08-15 | 2026-08-15 | 12 | Xin Net Technology Corporation |
| mayodele.com | mayo dele | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| spzs114.com | spzs 114 | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| cultivateob.com | cultivate ob | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| itongliang.com | i tong liang | 2014-08-05 | 2026-08-05 | 12 | Guangdong Nicenic Technology Co., Ltd. Dba Nicenic |
| glowmodernnutrition.com | glow modern nutrition | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| pesterhead.com | pester head | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| hayscarmelo.com | hays carmelo | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| v707.com | v 707 | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| zyqfx.com | zyqfx | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| hempshingles.com | hemp shingles | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| lbmdns.com | lbmdns | 2014-08-05 | 2026-08-05 | 12 | Tecnocrática Centro De Datos, S.L. |
| ck35.com | ck 35 | 2014-08-13 | 2026-08-13 | 12 | Hefei Juming Network Technology Co., Ltd |
| hotels-by-neighborhood.com | hotels by neighborhood | 2014-08-03 | 2026-08-03 | 12 | Ionos Se |
| isharesales.com | i share sales | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| badshorts.com | bad shorts | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| cacaoshaman.com | cacao shaman | 2014-08-02 | 2026-08-02 | 12 | Ionos Se |
| p3force.com | p 3 force | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| onedeliv.com | one deliv | 2014-08-02 | 2026-08-02 | 12 | 1Api Gmbh |
| myhouseetc.com | my house etc | 2014-07-31 | 2026-07-31 | 12 | Domain Registration Services, Inc. Dba Dotearth.Com |
| sunstreamedi.com | sun stream edi | 2014-11-05 | 2026-11-05 | 12 | GoDaddy |
| vothanhnhi.com | vo thanh nhi | 2014-08-04 | 2026-08-04 | 12 | Nhan Hoa Software Company Ltd. |
| jrscigars.com | jrs cigars | 2014-08-04 | 2026-08-04 | 12 | Above.Com Pty Ltd. |
| contrataciondeartistasculturales.com | contratacion de artistas culturales | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| bestleon.com | best leon | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| asiarevealed.com | asia revealed | 2014-08-12 | 2026-08-12 | 12 | Register Spa |
| bestlasikdoctororlando.com | best lasik doctor orlando | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| 3dprintingdirectories.com | 3d printing directories | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| 888lvyou.com | 888 lv you | 2014-08-14 | 2026-08-14 | 12 | Gname.Com Pte. Ltd. |
| yoyojiu.com | yoyo jiu | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| 420clubstore.com | 420 club store | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| sharkbaybalsa.com | shark bay balsa | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| contratarartistasenmexico.com | contratar artistas en mexico | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| sslkopen.com | ssl kopen | 2014-09-16 | 2026-09-16 | 12 | Key-Systems Gmbh |
| traumastopper.com | trauma stopper | 2014-11-05 | 2026-11-05 | 12 | GoDaddy |
| ghostpursuit.com | ghost pursuit | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| sousuow.com | sou suo w | 2014-08-13 | 2026-08-13 | 12 | Gname.Com Pte. Ltd. |
| mapleridgehealthcare.com | maple ridge healthcare | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| sanantoniotexasjobs.com | san antonio texas jobs | 2014-08-02 | 2026-08-02 | 12 | Epik Llc |
| whiteleafcoffeeandteaco.com | white leaf coffee and tea co | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| petsalonofbend.com | pet salon of bend | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| magnum-proff.com | magnum proff | 2014-08-11 | 2026-08-11 | 12 | Regional Network Information Center, Jsc Dba Ru-Center |
| feelbetterandmovebetter.com | feel better and move better | 2014-08-04 | 2026-08-04 | 12 | Tucows Domains Inc. |
| ctretireelife.com | ct retiree life | 2014-11-05 | 2026-11-05 | 12 | GoDaddy |
| dnasoles.com | dna soles | 2014-11-04 | 2026-11-04 | 12 | GoDaddy |
| bbq-smoker.com | bbq smoker | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| timesandlaws.com | times and laws | 2015-06-10 | 2027-06-10 | 12 | Wild West Domains, Llc |
| fatgirlthinworld.com | fat girl thin world | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| worldpeacefollowsinnerpeace.com | world peace follows inner peace | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| ambada.com | ambada | 2014-08-05 | 2026-08-05 | 12 | Gransy, S.R.O. |
| qingphp.com | qing php | 2014-08-06 | 2026-08-06 | 12 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| fromtheravens.com | from the ravens | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| hunanhibachibuffetwaukegan.com | hunan hibachi buffet waukegan | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| changetoshift.com | change to shift | 2014-12-11 | 2026-12-11 | 12 | GoDaddy |
| pornoesel.com | porno es el | 2014-08-03 | 2026-08-03 | 12 | Namecheap |
| luxtay.com | lux tay | 2014-08-04 | 2026-08-04 | 12 | Turncommerce, Inc. Dba Namebright.Com |
| comsmp.com | com smp | 2014-08-01 | 2026-08-01 | 12 | West263 International Limited |
| 844-new-cars.com | 844 new cars | 2014-08-04 | 2026-08-04 | 12 | GoDaddy |
| monique-haber.com | monique haber | 2014-08-02 | 2026-08-02 | 12 | Network Solutions, Llc |
| dx0830.com | dx 0830 | 2014-08-01 | 2026-08-01 | 12 | Chengdu West Dimension Digital Technology Co., Ltd. |
| tahoereg.com | tahoe reg | 2014-08-03 | 2026-08-03 | 12 | GoDaddy |
| snackboxpuffandpie.com | snack box puff and pie | 2014-08-03 | 2026-08-03 | 12 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| preciousdaysboutique.com | precious days boutique | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| dcbloomingdale.com | dc bloomingdale | 2015-08-03 | 2026-08-03 | 11 | Dreamhost, Llc |
| hudsonkim.com | hudson kim | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| stroesle.com | stroesle | 2015-08-13 | 2026-08-13 | 11 | Abion Ab |
| asapsettlements.com | asap settlements | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| welcometomorris.com | welcome to morris | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ra-mugi.com | ra mugi | 2015-08-03 | 2026-08-03 | 11 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| danielkeogan.com | daniel keogan | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| comfortshoedeal.com | comfort shoe deal | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| carolyncorrente.com | carolyn corrente | 2015-08-02 | 2026-08-02 | 11 | Register.Com – Network Solutions, Llc |
| karin-holdhaus.com | karin holdhaus | 2015-08-05 | 2026-08-05 | 11 | Onlinenic, Inc. |
| californiacannabisgrowersunited.com | california cannabis growers united | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| naturalqr.com | natural qr | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| lixiankun.com | li xian kun | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| blackbasque.com | black basque | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| bheldmanphoto.com | b heldman photo | 2015-08-02 | 2026-08-02 | 11 | Bluehost Inc. |
| jps-bondage.com | jps bondage | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| cdzhentan.com | cd zhen tan | 2015-08-01 | 2026-08-01 | 11 | Chengdu West Dimension Digital Technology Co., Ltd. |
| wrestling4you.com | wrestling 4 you | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| machinerytradeoff.com | machinery trade off | 2015-08-02 | 2026-08-02 | 11 | Key-Systems Gmbh |
| ywhpf.com | ywhpf | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| qingshuibo.com | qing shui bo | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| fearuniversity.com | fear university | 2015-12-14 | 2026-12-14 | 11 | GoDaddy |
| jaredjiang.com | jared jiang | 2015-08-03 | 2026-08-03 | 11 | Wild West Domains, Llc |
| fixjointpain.com | fix joint pain | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| plattsburgclinicpharmacy.com | plattsburg clinic pharmacy | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| deepminddesign.com | deep mind design | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| mafuta-energy.com | mafuta energy | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| philipsindustrialfacilitysolutions.com | philips industrial facility solutions | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| sloscape.com | slo scape | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| peppedesign.com | peppe design | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| pharmapackagingsupplies.com | pharma packaging supplies | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| ak-supplies.com | ak supplies | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| lubricateseattle.com | lubricate seattle | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| youmayougo.com | you ma you go | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| eia-mulhouse.com | eia mulhouse | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| ihanergy.com | i hanergy | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| moioproperties.com | moio properties | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| jabytools.com | jaby tools | 2015-08-02 | 2026-08-02 | 11 | Name.Com, Inc. |
| sayyestojps.com | say yes to jps | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| sprayz-of-sunshine.com | sprayz of sunshine | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| mazfresco.com | maz fresco | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| rolpstos.com | rolpstos | 2015-08-02 | 2026-08-02 | 11 | Domain.Com – Network Solutions, Llc |
| 5dhakot.com | 5d hakot | 2015-08-03 | 2026-08-03 | 11 | Spaceship, Inc. |
| aidshivvaccine.com | aid shiv vaccine | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| normandavidsonlaw.com | norman davidson law | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| dougpowellisadesigner.com | doug powell isa designer | 2016-06-09 | 2027-06-09 | 11 | Wild West Domains, Llc |
| mama-dame.com | mama dame | 2015-08-03 | 2026-08-03 | 11 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| hoorshawl.com | hoor shawl | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| ovuiilawyer.com | ovuii lawyer | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| vetrimurasu.com | vetri murasu | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| indian-hotel.com | indian hotel | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| mcrdesigns.com | mcr designs | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| rslnational.com | rsl national | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| pixanomaly.com | pix anomaly | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| watersideinstallations.com | waterside installations | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| bankruptcyattorneysgroup.com | bankruptcy attorneys group | 2015-08-13 | 2026-08-13 | 11 | Abion Ab |
| rptong.com | rp tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| moneyinmotionllc.com | money in motion llc | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| hyperwealthtransformation.com | hyper wealth transformation | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| lfaccl.com | lfaccl | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| nktong.com | nk tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| iowacityhomesandhearth.com | iowa city homes and hearth | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| muslimwomenforusa.com | muslim women for usa | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| 17gaole.com | 17 gao le | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| shihangwei.com | shi hang wei | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| doxiecountry.com | doxie country | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| debrahoren.com | debra horen | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| tameronhondaofgadsden.com | tameron honda of gadsden | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| mworders.com | mworders | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| indcomenterprises.com | ind com enterprises | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| alunsjo.com | alunsjo | 2015-08-04 | 2026-08-04 | 11 | Domeneshop As Dba Domainnameshop.Com |
| bytpix.com | byt pix | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| bandarhl8.com | bandar hl 8 | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| minoya8929.com | minoya 8929 | 2015-08-03 | 2026-08-03 | 11 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| illbehereforyou.com | ill be here for you | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| arbestvending.com | arbestvending | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| nurimadina.com | nuri madina | 2015-08-04 | 2026-08-04 | 11 | Wild West Domains, Llc |
| diligentflooring.com | diligent flooring | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| bodabiz.com | boda biz | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| jsfwzx.com | jsfwzx | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| beerealskincare.com | beereal skincare | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| comfortshoesales.com | comfort shoe sales | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| amazonclients.com | amazon clients | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| notchmakers.com | notch makers | 2016-05-12 | 2027-05-12 | 11 | 1Api Gmbh |
| chrisandlarrel.com | chris and larrel | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| xinlai8888.com | xin lai 8888 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| graffiti-wines.com | graffiti wines | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| brackitapp.com | brackit app | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| accentbiosystems.com | accent biosystems | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| korchaginstudio.com | korchagin studio | 2015-08-06 | 2026-08-06 | 11 | Registrar Of Domain Names Reg.Ru Llc |
| hypnose-hypnologue-quebec.com | hypnose hypnologue quebec | 2015-08-03 | 2026-08-03 | 11 | Whc Online Solutions Inc. |
| kky8.com | kky 8 | 2015-08-12 | 2026-08-12 | 11 | Bizcn.Com, Inc. |
| bridgetwohealth.com | bridge two health | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| azbankruptcydivorces.com | az bankruptcy divorces | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| mothersagainstgunviolence.com | mothers against gun violence | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| iredelljoblink.com | iredell job link | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| homepart2.com | home part 2 | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| karnawatgroup.com | karnawat group | 2015-08-03 | 2026-08-03 | 11 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| vostokshina.com | vostok shina | 2015-08-06 | 2026-08-06 | 11 | Onlinenic, Inc. |
| waggingtailshappyheartsgrooming.com | wagging tails happy hearts grooming | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| graphicpurpose.com | graphic purpose | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| corralespharmacy.com | corrales pharmacy | 2015-08-03 | 2026-08-03 | 11 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| elitemodelingagency.com | elite modeling agency | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| mqtong.com | mq tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| belvitrix.com | belvitrix | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ginakwak.com | gina kwak | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| poseidon-digital.com | poseidon digital | 2015-09-28 | 2026-09-28 | 11 | Vautron Rechenzentrum Ag |
| lonelyartdaze.com | lonely art daze | 2015-08-04 | 2026-08-04 | 11 | NameSilo |
| westernexpressdrivingschool.com | western express driving school | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| qhonerotica.com | qhon erotica | 2015-08-03 | 2026-08-03 | 11 | Go France Domains, Llc |
| xn--65qs6v.com | xn--65qs6v | 2015-08-03 | 2026-08-03 | 11 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| bearlakessd.com | bear lakes sd | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| yuejinjia.com | yue jin jia | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| unica-petra.com | unica petra | 2015-10-11 | 2026-10-11 | 11 | Registrygate Gmbh |
| iserps.com | iserps | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| phxmae.com | phx mae | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| porn234.com | porn 234 | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| cxyjm.com | cxyjm | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| troyadrilling.com | troya drilling | 2015-08-05 | 2026-08-05 | 11 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| liberty-motorcycles.com | liberty motorcycles | 2016-01-07 | 2027-01-07 | 11 | Orange |
| watathk.com | watathk | 2015-08-04 | 2026-08-04 | 11 | Wild West Domains, Llc |
| fourseasonssunroomannarbor.com | four seasons sunroom ann arbor | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| ziyouban.com | zi you ban | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| clyt518.com | clyt 518 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| gpjewellery.com | gp jewellery | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ruixiangbee.com | rui xiang bee | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| dangerkhabar.com | danger khabar | 2015-08-03 | 2026-08-03 | 11 | Bigrock Solutions Ltd. |
| mamajovitas.com | mama jovitas | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| organicmilitia.com | organic militia | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| dragliving.com | drag living | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| sahebindan.com | saheb indan | 2015-08-01 | 2026-08-01 | 11 | Key-Systems Gmbh |
| findpallets.com | find pallets | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| mappstock.com | mapp stock | 2015-08-03 | 2026-08-03 | 11 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| hengdikeji.com | heng di ke ji | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| exquisitethelabel.com | exquisite the label | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| organizingmychaos.com | organizing my chaos | 2015-08-03 | 2026-08-03 | 11 | Wild West Domains, Llc |
| cherylmistrettaphotography.com | cheryl mistretta photography | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| beyondstocksbonds.com | beyond stocks bonds | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| mauriciomorel.com | mauricio morel | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| friendsoffriendsllc.com | friends of friends llc | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| janainaflauzino.com | janaina flauzino | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| ace1apparel.com | ace 1 apparel | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| partyscopes.com | party scopes | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| shirojoy.com | shiro joy | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| huqingsong.com | hu qing song | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| turksezonvakanties.com | turkse zon vakanties | 2015-09-16 | 2026-09-16 | 11 | Realtime Register B.V. |
| deskexistence.com | desk existence | 2015-08-02 | 2026-08-02 | 11 | 1Api Gmbh |
| practiceproductions.com | practice productions | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| pinzambo.com | pinzambo | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| bobblebabies.com | bobble babies | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| jpsyesbond.com | jps yes bond | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| honeycompanion.com | honey companion | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| imagesourcecreative.com | image source creative | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| mariaborgio.com | maria borgio | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| seemg.com | seemg | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| pointears.com | point ears | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| backroutes.com | back routes | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| sporaticfanatic.com | sporatic fanatic | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| iibrothersbar.com | ii brothers bar | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| hbjuran.com | hb juran | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| felipecaon.com | felipe caon | 2015-08-03 | 2026-08-03 | 11 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| herjazzyjamsbeautyspa.com | her jazzy jams beauty spa | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| plottl.com | plottl | 2015-08-03 | 2026-08-03 | 11 | Whc Online Solutions Inc. |
| skyrusmedia.com | skyrus media | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| fgtong.com | fg tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| spencereid.com | spencer eid | 2015-03-02 | 2026-11-04 | 11 | GoDaddy |
| dzanahoman.com | dzana homan | 2015-11-05 | 2026-11-05 | 11 | GoDaddy |
| operationalfeatures.com | operational features | 2015-08-02 | 2026-08-02 | 11 | Ionos Se |
| pnwstockimages.com | pnw stock images | 2015-08-05 | 2026-08-05 | 11 | Pair Networks, Inc. D/B/A Pair Domains |
| wwwfirstprogress.com | www first progress | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| guifanwang.com | gui fan wang | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| ashtonleadesigns.com | ashton lea designs | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| izamusicacademy.com | iza music academy | 2015-02-08 | 2026-11-04 | 11 | GoDaddy |
| hotelscostaricavacations.com | hotels costa rica vacations | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| thisislifejoy.com | this is life joy | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| guardiancounseling.com | guardian counseling | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| resuwiz.com | resuwiz | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| idukou.com | i du kou | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| futureelectricians.com | future electricians | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| carfilm-nakamura.com | car film nakamura | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| videoservicesagency.com | video services agency | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| trtong.com | tr tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| talleresberri.com | talleres berri | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| nojps.com | no jps | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| cctvgenesis.com | cctv genesis | 2015-08-14 | 2026-08-14 | 11 | Vitalwerks Internet Solutions, Llc Dba No-Ip |
| fontanatowers.com | fontana towers | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| whjcfy.com | whjcfy | 2015-08-06 | 2026-08-06 | 11 | Maff Inc. |
| dragonboatpost.com | dragon boat post | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| talknrl.com | talk nrl | 2015-09-18 | 2026-09-18 | 11 | Csc Corporate Domains, Inc. |
| eimarypoppins.com | ei mary poppins | 2015-08-12 | 2026-08-12 | 11 | Nominalia Internet S.L. |
| zhenshibaozhuangji.com | zhen shi bao zhuang ji | 2015-08-07 | 2026-08-07 | 11 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| quintemodelshipwrights.com | quinte model shipwrights | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| nqtong.com | nq tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| thekillah.com | the killah | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| 51xiaogou.com | 51 xiao gou | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| annaaxxa.com | anna axxa | 2016-06-09 | 2027-06-09 | 11 | Wild West Domains, Llc |
| 792323.com | 792323 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| gonghuizhuan.com | gong hui zhuan | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| yiqiebao.com | yi qie bao | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| crducker.com | cr ducker | 2015-08-12 | 2026-08-12 | 11 | Register Spa |
| zhenziwo.com | zhen zi wo | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| cttong.com | ct tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| create-tattoos.com | create tattoos | 2015-08-04 | 2026-08-04 | 11 | NameSilo |
| quickhaulz.com | quick haulz | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| alltheworkthings.com | all the work things | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| mudmulisha.com | mud mulisha | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| csaladi.com | csaladi | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| 123microtec.com | 123 microtec | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| steffeninivalves.com | steffen ini valves | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| fibrepatchpanel.com | fibre patch panel | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| buchelcorp.com | buchel corp | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| xn--zf4b80km3av34a.com | xn--zf4b80km3av34a | 2015-08-03 | 2026-08-03 | 11 | Dotname Korea Corp. |
| esv-mulhouse.com | esv mulhouse | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| montageuae.com | montage uae | 2015-08-02 | 2026-08-02 | 11 | Ionos Se |
| yesjpsbonds.com | yes jps bonds | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| quantswealth.com | quants wealth | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| germanherbs.com | german herbs | 2015-08-05 | 2026-08-05 | 11 | Web Commerce Communications Limited Dba Webnic.Cc |
| crazysportsmom.com | crazy sports mom | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| justzumbaon.com | just zumba on | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| linemanbrewingcompany.com | lineman brewing company | 2015-08-02 | 2026-08-02 | 11 | Register.Com – Network Solutions, Llc |
| dignicapusa.com | dignicap usa | 2015-09-14 | 2026-09-14 | 11 | Ascio Technologies, Inc. Danmark – Filial Af Ascio Technologies, Inc. Usa |
| globalideasblog.com | global ideas blog | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| socialmediamarketinglisboa.com | social media marketing lisboa | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| royal-duke.com | royal duke | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| 1-1inc.com | 1 1 inc | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| bbl147.com | bbl 147 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| getoutofmykitchen.com | get out of my kitchen | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| daviddiaz3d.com | david diaz 3d | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| magnadrone.com | magna drone | 2015-08-02 | 2026-08-02 | 11 | Spaceship, Inc. |
| ddlrecruitment.com | ddl recruitment | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| heimausstattung.com | heim ausstattung | 2015-09-10 | 2026-09-10 | 11 | 1Api Gmbh |
| 21benke.com | 21 benke | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| leventbh.com | levent bh | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| mimaroli.com | mimaroli | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| jttong.com | jt tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| cityphrases.com | city phrases | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| eicwheels.com | eic wheels | 2015-08-03 | 2026-08-03 | 11 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| ukopinion.com | uk opinion | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| spargutscheine.com | spar gutscheine | 2015-08-02 | 2026-08-02 | 11 | 1Api Gmbh |
| pzcxt.com | pzcxt | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| hellfiretoursnyc.com | hellfire tours nyc | 2015-08-03 | 2026-08-03 | 11 | Ionos Se |
| ahjinye.com | ah jin ye | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| connectedislam.com | connected islam | 2015-08-02 | 2026-08-02 | 11 | Name.Com, Inc. |
| ryenvictoria.com | ryen victoria | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| goldanodizing.com | gold anodizing | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| kwayelaunivers.com | kwayela univers | 2015-08-03 | 2026-08-03 | 11 | Name Srs Ab |
| primarycarefinancial.com | primary care financial | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| sustainableoliveoil.com | sustainable olive oil | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| randdtooling.com | r and d tooling | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| mubarake.com | mubarake | 2015-08-03 | 2026-08-03 | 11 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| ovuiiattorney.com | ovuii attorney | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| sellmyvxr.com | sell my vxr | 2015-08-12 | 2026-08-12 | 11 | Register Spa |
| gobeewireless.com | go bee wireless | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| soapsbyromero.com | soaps by romero | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| cuwenay.com | cuwenay | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| nttsite.com | ntt site | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| tasmiahalam.com | tasmiah alam | 2015-08-05 | 2026-08-05 | 11 | Dynadot |
| bestidentitytheftprotectionproduct.com | best identity theft protection product | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| whattvshowisthis.com | what tv show is this | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| zhimaoqu.com | zhi mao qu | 2015-08-07 | 2026-08-07 | 11 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| shuxinshebao.com | shu xin she bao | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| 753899.com | 753899 | 2015-08-05 | 2026-08-05 | 11 | Guangdong Nicenic Technology Co., Ltd. Dba Nicenic |
| akinibook.com | akini book | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| cauche.com | cauche | 2015-08-14 | 2026-08-14 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| deurtyboys.com | deurty boys | 2015-08-02 | 2026-08-02 | 11 | Enom, Llc |
| watsonshorttermrentals.com | watson short term rentals | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| d0rikamon.com | d0rikamon | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| uootools.com | uoo tools | 2015-08-15 | 2026-08-15 | 11 | Dnspod, Inc. |
| sweetlovebegins.com | sweet love begins | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| bcottica.com | bcottica | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| urologyandkidneystone.com | urology and kidney stone | 2015-08-03 | 2026-08-03 | 11 | Bigrock Solutions Ltd. |
| 50shadesofwtf.com | 50 shades of wtf | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| tamireder.com | tamireder | 2015-08-02 | 2026-08-02 | 11 | İSimtescil Bilişim A.Ş. |
| vonfused.com | vonfused | 2015-08-05 | 2026-08-05 | 11 | Gransy, S.R.O. |
| bigbandmils.com | big band mils | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| bemoviez.com | be moviez | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| xinjiangbazha.com | xin jiang ba zha | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| digiquestmedia.com | digiquest media | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| dinoshome.com | dinos home | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| kimhandysidesauthor.com | kim handysides author | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| dallaswatchandclockrepair.com | dallas watch and clock repair | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| globalmonte.com | global monte | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| iibrothersgrill.com | ii brothers grill | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| rosanneberube.com | rosanne berube | 2015-08-03 | 2026-08-03 | 11 | Whc Online Solutions Inc. |
| cnsxxx.com | cns xxx | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| pihugoyal.com | pihu goyal | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| willowgroveshowroom.com | willow grove showroom | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| lrtong.com | lr tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| ztsjhxwh.com | ztsjhxwh | 2015-08-04 | 2026-08-04 | 11 | NameSilo |
| munesho.com | munesho | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| sheepbunga.com | sheep bunga | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| marketingandmobile.com | marketing and mobile | 2015-08-04 | 2026-08-04 | 11 | Domeneshop As Dba Domainnameshop.Com |
| xn--mxaa5atjgd1b.com | xn--mxaa5atjgd1b | 2015-08-05 | 2026-08-05 | 11 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| c21rockiesrealty.com | c21 rockies realty | 2015-08-04 | 2026-08-04 | 11 | Namespro Solutions Inc. |
| thelittlebeachhousevacationrental.com | the little beach house vacation rental | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| heavydtraining.com | heavy d training | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| koukyoukouji.com | kou kyou kou ji | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| darkunicorns.com | dark unicorns | 2015-08-03 | 2026-08-03 | 11 | Soluciones Corporativas Ip, Sl |
| clientesocultos.com | clientes ocultos | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| dncinsights.com | dnc insights | 2016-02-10 | 2027-02-10 | 11 | Wild West Domains, Llc |
| biia-dots.com | biia dots | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| amecfw-bbs.com | amecfw bbs | 2015-08-20 | 2026-08-20 | 11 | Safenames Ltd. |
| wuchuhua.com | wu chu hua | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| dhy22.com | dhy 22 | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| globalcim.com | global cim | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| 87yw.com | 87 yw | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| communeclub.com | commune club | 2015-08-02 | 2026-08-02 | 11 | Register.Com – Network Solutions, Llc |
| mystylight.com | my sty light | 2015-08-01 | 2026-08-01 | 11 | United-Domains Gmbh |
| anjiermuying.com | an jier mu ying | 2015-08-12 | 2026-08-12 | 11 | Bizcn.Com, Inc. |
| rntong.com | rn tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| gzhysoft.com | gz hy soft | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| co2renu.com | co2 renu | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| 10toplist.com | 10 top list | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| wanshang-hao.com | wan shang hao | 2015-08-05 | 2026-08-05 | 11 | Eurodns S.A. |
| echohearingupperstclair.com | echo hearing upper st clair | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| lakelandselfdefense.com | lakeland self defense | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| casaenatlanta.com | casa en atlanta | 2016-08-03 | 2027-08-04 | 11 | GoDaddy |
| mcmedall.com | mc medall | 2015-08-11 | 2026-08-11 | 11 | Regional Network Information Center, Jsc Dba Ru-Center |
| jmmoser.com | jm moser | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| lookscanny.com | looks canny | 2015-08-03 | 2026-08-03 | 11 | Name Srs Ab |
| purchaseadegree.com | purchase a degree | 2015-08-05 | 2026-08-05 | 11 | Dynadot |
| reisewirtschaft.com | reise wirtschaft | 2015-10-01 | 2026-10-01 | 11 | Registrygate Gmbh |
| slimcakes.com | slim cakes | 2015-08-01 | 2026-08-01 | 11 | Sav.Com, Llc |
| tptong.com | tp tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| hkbnbg.com | hkbnbg | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| rttong.com | rt tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| journeyswithjessica.com | journeys with jessica | 2015-08-02 | 2026-08-02 | 11 | Moniker Online Services Llc |
| 21dayshappiness.com | 21 days happiness | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ventaredonda.com | venta redonda | 2015-08-05 | 2026-08-05 | 11 | Cloudflare, Inc. |
| sohbetsayfam.com | sohbet sayfam | 2015-08-04 | 2026-08-04 | 11 | Ihs Telekom, Inc. |
| theacceptors.com | the acceptors | 2015-12-18 | 2026-12-18 | 11 | GoDaddy |
| xxlkeukens.com | xxl keukens | 2015-08-05 | 2026-08-05 | 11 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| victoryheatingcooling.com | victory heating cooling | 2015-11-05 | 2026-11-05 | 11 | GoDaddy |
| youqipin.com | you qi pin | 2015-08-07 | 2026-08-07 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| xinbeijia.com | xin bei jia | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| bestidentitytheftprotectionservice.com | best identity theft protection service | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| winswayedu.com | wins way edu | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| yesjps.com | yes jps | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| jpsbonds.com | jps bonds | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| aerotitanllc.com | aero titan llc | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| 826161.com | 826161 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| elamarrado.com | el amarrado | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| spacesaverinterior.com | space saver interior | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| jtequine.com | jt equine | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| strussle.com | strussle | 2015-08-13 | 2026-08-13 | 11 | Abion Ab |
| sportjx.com | sport jx | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| jzwhy.com | jz why | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| prayandshare.com | pray and share | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| lostwalletprotectionplan.com | lost wallet protection plan | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| xiaobaixueche.com | xiao bai xue che | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| themoodsofbeauty.com | the moods of beauty | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| syriakontor.com | syria kontor | 2015-08-05 | 2026-08-05 | 11 | Cloudflare, Inc. |
| evcchemtech.com | evc chem tech | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| dkluxuryhomes.com | dk luxury homes | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| macamama.com | maca mama | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| xironggz.com | xi rong gz | 2015-08-07 | 2026-08-07 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| masstortplaybook.com | mass tort playbook | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| anjandasdesign.com | anjan das design | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| tntong.com | tn tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| microservicemarketplace.com | micro service marketplace | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| myvoalte.com | my voalte | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| healthaidetrainingcenter.com | health aide training center | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| legendconsultinggroup.com | legend consulting group | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| landecompass.com | landecompass | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| jrgood.com | jr good | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| lagunahomefinder.com | laguna home finder | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| vitacoveusa.com | vita cove usa | 2015-08-02 | 2026-08-02 | 11 | Launchpad.Com Inc. |
| dgbiaodeng.com | dg biao deng | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| digiquestllc.com | digiquest llc | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| remzhukuk.com | remzhukuk | 2015-08-04 | 2026-08-04 | 11 | Çizgi Telekomunikasyon A.Ş. |
| pustakalebah.com | pustaka lebah | 2015-08-05 | 2026-08-05 | 11 | Web Commerce Communications Limited Dba Webnic.Cc |
| womenveteranspeakers.com | women veteran speakers | 2015-10-07 | 2026-10-07 | 11 | GoDaddy |
| stansrailpix.com | stans rail pix | 2015-08-14 | 2026-08-14 | 11 | Ionos Se |
| notitulua.com | noti tulua | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| utilsercorp.com | util ser corp | 2015-08-03 | 2026-08-03 | 11 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| bptong.com | bp tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| sparkcounter.com | spark counter | 2015-08-02 | 2026-08-02 | 11 | Ionos Se |
| drivetodaycard.com | drive today card | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| deborahgouffranstudio.com | deborah gouffran studio | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| matoushuo.com | ma tou shuo | 2015-08-13 | 2026-08-13 | 11 | Hefei Juming Network Technology Co., Ltd |
| thefrequencyexchange.com | the frequency exchange | 2015-08-05 | 2026-08-05 | 11 | Dynadot |
| 100essay.com | 100 essay | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| balkanrunner.com | balkan runner | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| aipfpolo.com | aipf polo | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| splicehentertainment.com | splice h entertainment | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| stpetemri.com | st pete mri | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| daiichi-rt.com | daiichi rt | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| wzhaocha.com | w zhao cha | 2015-08-15 | 2026-08-15 | 11 | Xin Net Technology Corporation |
| web-of-systems.com | web of systems | 2016-02-29 | 2027-02-28 | 11 | Amazon Registrar, Inc. |
| cemresahin.com | cemre sahin | 2015-08-04 | 2026-08-04 | 11 | NameSilo |
| ljmenterprisesllc.com | ljm enterprises llc | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| muskokafood.com | muskoka food | 2015-08-04 | 2026-08-04 | 11 | Namespro Solutions Inc. |
| northsideditions.com | north side ditions | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| ubuntuempowermentcircle.com | ubuntu empowerment circle | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| notojps.com | noto jps | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| livelyartsdance.com | lively arts dance | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| djsjs.com | djsjs | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| biothermalsolutions.com | biothermal solutions | 2015-08-03 | 2026-08-03 | 11 | Spaceship, Inc. |
| planallevents.com | plan all events | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| wewalkthru.com | we walk thru | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| bukumasakan.com | buku masakan | 2015-08-05 | 2026-08-05 | 11 | Web Commerce Communications Limited Dba Webnic.Cc |
| wulianjie.com | wu lian jie | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| fontanacitycentre.com | fontana city centre | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| westwoodprefab.com | westwood prefab | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| 9create.com | 9 create | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| procaremassage.com | pro care massage | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| xn--72ccd6d0bdce9duae4bi9bh8ozf.com | xn--72ccd6d0bdce9duae4bi9bh8ozf | 2015-08-03 | 2026-08-03 | 11 | Wild West Domains, Llc |
| divorcedletstalk.com | divorced lets talk | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| redwingmarinespecialties.com | red wing marine specialties | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| gddgjs.com | gd dg js | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| zadorenko.com | zadorenko | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| smptecables.com | smpte cables | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| caritagenetics.com | carita genetics | 2015-08-12 | 2026-08-12 | 11 | Register Spa |
| fn-it.com | fn it | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| rimel3d.com | rimel 3d | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| teamburack.com | team burack | 2015-08-04 | 2026-08-04 | 11 | NameSilo |
| dirtroutes.com | dirt routes | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| khurius.com | khurius | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| sthbtz.com | sthbtz | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| blkcs.com | blkcs | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| shopjuliana.com | shop juliana | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| mainemomsdemandaction.com | maine moms demand action | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| szyiruibo.com | sz yi rui bo | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| tk-mexico.com | tk mexico | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| kuwandao.com | ku wan dao | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| verbenawellness.com | verbena wellness | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| ahguanbo.com | ah guan bo | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| manyishequ.com | man yi she qu | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| thetefillinbooth.com | the tefillin booth | 2015-08-03 | 2026-08-03 | 11 | Spaceship, Inc. |
| 51juhao.com | 51 ju hao | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| cokhithuyluc.com | co khi thuy luc | 2015-08-15 | 2026-08-15 | 11 | Mat Bao Corporation |
| dontgetstuckwith2houses.com | dont get stuck with 2 houses | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| fengyupianpian.com | feng yu pian pian | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| allpusyallday.com | all pusy all day | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ershadrealestate.com | ershad real estate | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| jzhuayi.com | jz huayi | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| ilkleyartsfestival.com | ilkley arts festival | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| skyotaku.com | sky otaku | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| forentenerji.com | forent enerji | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| homegnomeapp.com | home gnome app | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| call2self.com | call 2 self | 2015-08-05 | 2026-08-05 | 11 | Rebel Ltd |
| restaurantdesignshow.com | restaurant design show | 2015-08-03 | 2026-08-03 | 11 | 123-Reg Limited |
| pinnaviardoarchitetti.com | pin naviardo architetti | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| wsfbw.com | wsfbw | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| tourdecreemore.com | tour de creemore | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| bigbusinessbrokers.com | big business brokers | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| recrowngroup.com | re crown group | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| thexxxvideos.com | the xxx videos | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| toyota-morlaix.com | toyota morlaix | 2015-09-23 | 2026-09-23 | 11 | Orange |
| destinationcreativity.com | destination creativity | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| superherodaughterday.com | super hero daughter day | 2017-02-13 | 2028-02-13 | 11 | GoDaddy |
| dantotsu-benchmarking.com | dantotsu benchmarking | 2015-09-16 | 2026-09-16 | 11 | Realtime Register B.V. |
| zhubang99.com | zhu bang 99 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| shadyfisherman.com | shady fisherman | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| wijzijnlekker.com | wij zijn lekker | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| akindermann.com | a kindermann | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| phoenixsoftlimited.com | phoenix soft limited | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ravikamepalli.com | ravi kamepalli | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| iteranexcoaching.com | iteranex coaching | 2015-08-02 | 2026-08-02 | 11 | Register.Com – Network Solutions, Llc |
| hbqsg.com | hbqsg | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| elreplicante.com | el replicante | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| podiatriststevenage.com | podiatrist stevenage | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| cyberchronic.com | cyber chronic | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| blitzinteractivemedia.com | blitz interactive media | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| lisaono.com | lisa ono | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| enquete-periph-nord.com | enquete periph nord | 2016-06-20 | 2027-06-20 | 11 | Ovh Sas |
| lktong.com | lk tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| pawpawbear.com | paw paw bear | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| debbiedoesdiapers.com | debbie does diapers | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| expresscapade.com | express capade | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| silvaplumbinginc.com | silva plumbing inc | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| otohungphat.com | oto hung phat | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| teelthereisacure.com | teel there is a cure | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| mindenhurst.com | mindenhurst | 2015-09-18 | 2026-09-18 | 11 | Csc Corporate Domains, Inc. |
| songsongliwu.com | song song li wu | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| betchmoji.com | betch moji | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| apsplastering.com | aps plastering | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| 553589.com | 553589 | 2015-08-05 | 2026-08-05 | 11 | Guangdong Nicenic Technology Co., Ltd. Dba Nicenic |
| mtriggo.com | mtriggo | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| esomein.com | esomein | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| portageshoreapts.com | portage shore apts | 2015-08-05 | 2026-08-05 | 11 | Dynadot |
| jpsyesbonds.com | jps yes bonds | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| 0851a.com | 0851 a | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| jing-c.com | jing c | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| ibmibv116.com | ibm ibv 116 | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| earlyadvantagepartners.com | early advantage partners | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| morelikesisters.com | more like sisters | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| banrichan.com | ban ri chan | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| wildseasalt.com | wild sea salt | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| gruppodedalo.com | gruppo dedalo | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| amssny.com | amss ny | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| edu-designing.com | edu designing | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| eliandai.com | eli and ai | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| mainexchangefdl.com | main exchange fdl | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| umecolima.com | ume colima | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| smallfarmworld.com | small farm world | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| noveltyroom.com | novelty room | 2015-08-02 | 2026-08-02 | 11 | Spaceship, Inc. |
| goodtimesbird.com | good times bird | 2019-01-08 | 2030-01-08 | 11 | GoDaddy |
| sysfl.com | sysfl | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| juniorlogic.com | junior logic | 2015-08-03 | 2026-08-03 | 11 | Realtime Register B.V. |
| lhsfinancas.com | lhs financas | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| rugbyza.com | rugby za | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| wohncontainerkaufen.com | wohn container kaufen | 2015-09-16 | 2026-09-16 | 11 | Vautron Rechenzentrum Ag |
| shadesroyal.com | shades royal | 2015-08-02 | 2026-08-02 | 11 | Ionos Se |
| katesboutiqueshop.com | kates boutique shop | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| hsmcolombia.com | hsm colombia | 2015-08-03 | 2026-08-03 | 11 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| racheh.com | racheh | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| gr8tleader.com | gr8t leader | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| wlmqzwz.com | wlmqzwz | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| atlantasoca.com | atlanta soca | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| hexinquan.com | he xin quan | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| leyouyang.com | le you yang | 2015-08-07 | 2026-08-07 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| nanjingkaoyan.com | nan jing kao yan | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| energysaversofgoldsboro.com | energy savers of goldsboro | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| things2mobile.com | things 2 mobile | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| bermondseyapartments.com | bermondsey apartments | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| frontviewcameras.com | front view cameras | 2015-08-04 | 2026-08-04 | 11 | Dynadot |
| breadcoholic.com | bread coholic | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| pioneerspro.com | pioneers pro | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| scotiacharters.com | scotia charters | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| rcf2011.com | rcf 2011 | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| hagarconstructionllc.com | hagar construction llc | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| stuartcaldecourt.com | stuart caldecourt | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| tctextile.com | tc textile | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| jsfhy.com | jsfhy | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| joviderm.com | joviderm | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| joeythinks.com | joey thinks | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| dallasclockandwatchrepair.com | dallas clock and watch repair | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| emsinsidesales.com | ems inside sales | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| mermaidsandmotorcycles.com | mermaids and motorcycles | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| sensugala.com | sensu gala | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| pittsburghseoservice.com | pittsburgh seo service | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| 51guifan.com | 51 gui fan | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| bpgceramic.com | bpg ceramic | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| therasolutionsllc.com | thera solutions llc | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| topsecretariat.com | top secretariat | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| dntong.com | dn tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| findexjapan.com | f index japan | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| adonrealty.com | adon realty | 2015-08-06 | 2026-08-06 | 11 | Registrar Of Domain Names Reg.Ru Llc |
| tofscareers.com | tofs careers | 2015-08-05 | 2026-08-05 | 11 | Eurodns S.A. |
| hekmantranslations.com | hekman translations | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| jackharveyhomes.com | jack harvey homes | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| atrustwalk.com | a trust walk | 2016-08-02 | 2027-08-02 | 11 | Domain.Com – Network Solutions, Llc |
| backbone-corp.com | backbone corp | 2015-08-02 | 2026-08-02 | 11 | Hostinger Operations, Uab |
| zimbuka.com | zimbuka | 2015-09-16 | 2026-09-16 | 11 | Key-Systems Gmbh |
| alliedallcity-inc.com | allied all city inc | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| chriselectricinc.com | chris electric inc | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| cyclingza.com | cycling za | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| caffir.com | caffir | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| technehire.com | techne hire | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| faguagroup.com | fa gua group | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| sayyes2jps.com | say yes 2 jps | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| superiorrefinish.com | superior refinish | 2015-08-04 | 2026-08-04 | 11 | NameSilo |
| thesiannadh.com | the sian nadh | 2015-08-03 | 2026-08-03 | 11 | Dreamhost, Llc |
| hilltoppharm.com | hilltop pharm | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| cdrdym.com | cdrdym | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| realgoodluck.com | real good luck | 2015-08-02 | 2026-08-02 | 11 | Bluehost Inc. |
| acornvacparts.com | acorn vac parts | 2015-08-15 | 2026-08-15 | 11 | Domain-It!, Inc. |
| tzjxwz.com | tzjxwz | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| zhtseo.com | zht seo | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| pagelawpa.com | page law pa | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| 796game.com | 796 game | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| pintervention.com | p intervention | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| hoorshal.com | hoorshal | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| casaorus.com | casa orus | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| thezenth.com | the zenth | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| mentis-assessments.com | mentis assessments | 2016-08-16 | 2027-08-16 | 11 | Mesh Digital Limited |
| ymnlhy.com | ymnlhy | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| stsdsj.com | stsdsj | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| pabloplacevacationrental.com | pablo place vacation rental | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| fptong.com | fp tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| silverleaflimo.com | silver leaf limo | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| yourweightlossfairy.com | your weight loss fairy | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| portlandsurveys.com | portland surveys | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| melissaallisonart.com | melissa allison art | 2015-11-04 | 2026-11-04 | 11 | Wild West Domains, Llc |
| gintheke.com | gintheke | 2015-08-01 | 2026-08-01 | 11 | Mesh Digital Limited |
| eezpro.com | eez pro | 2016-05-25 | 2027-05-25 | 11 | GoDaddy |
| jisuhyun.com | ji su hyun | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| fjdyrh.com | fjdyrh | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| halcyonanalytics.com | halcyon analytics | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| andradesignllc.com | andradesignllc | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| hotelinsidernews.com | hotel insider news | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| zhulusiyi.com | zhu lu si yi | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| thecoveresorthoa.com | the cove resort hoa | 2015-08-03 | 2026-08-03 | 11 | Dnc Holdings, Inc. |
| lexuegroup.com | le xue group | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| herjazzyjams.com | her jazzy jams | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| topbankruptcyattorneychicago.com | top bankruptcy attorney chicago | 2015-08-13 | 2026-08-13 | 11 | Abion Ab |
| msyin.com | ms yin | 2015-08-07 | 2026-08-07 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| publicsafetypeersupportassociation.com | public safe typeer support association | 2015-08-03 | 2026-08-03 | 11 | Wild West Domains, Llc |
| myspagoods.com | my spa goods | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| zfcjw.com | zfcjw | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| slowpitchedu.com | slow pitch edu | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| jpsyes.com | jps yes | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ourvisionyourfuture.com | our vision your future | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| quanmincai.com | quan min cai | 2015-08-05 | 2026-08-05 | 11 | Dynadot |
| mirrorfront.com | mirror front | 2015-09-25 | 2026-09-25 | 11 | 1Api Gmbh |
| grubberheads.com | grubber heads | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| lechappeebleue.com | le chappee bleue | 2015-08-04 | 2026-08-04 | 11 | Above.Com Pty Ltd. |
| thetefillinstand.com | the tefillin stand | 2015-08-03 | 2026-08-03 | 11 | Spaceship, Inc. |
| wttong.com | wt tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| aliviocorp.com | alivio corp | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| btsjyx.com | bts jyx | 2015-08-07 | 2026-08-07 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| cuidaatufamilia.com | cuida a tu familia | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| matsuoshonika.com | matsuo shonika | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| veguetamotor.com | vegueta motor | 2015-08-05 | 2026-08-05 | 11 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| libertybattson.com | liberty battson | 2015-08-03 | 2026-08-03 | 11 | Wild West Domains, Llc |
| calicoartists.com | calico artists | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| amitexmalta.com | amitex malta | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| daniellesmurray.com | danielles murray | 2015-08-03 | 2026-08-03 | 11 | Bluehost Inc. |
| czjinge.com | cz jinge | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| speechiekate.com | speechie kate | 2016-10-13 | 2027-10-13 | 11 | Wild West Domains, Llc |
| steeleconstructionco.com | steele construction co | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| plannerinsidernews.com | planner insider news | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| tk-unitedstates.com | tk united states | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| armanitmd.com | armani tmd | 2015-08-05 | 2026-08-05 | 11 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| mk-graphix.com | mk graphix | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| fewo-wremen.com | fewo wremen | 2015-08-05 | 2026-08-05 | 11 | Internetx Gmbh |
| liisaroll.com | liisa roll | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| streetrodphotoart.com | street rod photo art | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| politifreak.com | politi freak | 2015-08-03 | 2026-08-03 | 11 | Spaceship, Inc. |
| americansatelite.com | american satelite | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| homeknome.com | home knome | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| drorlahat.com | dror lahat | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| rotomarketplace.com | roto marketplace | 2015-08-03 | 2026-08-03 | 11 | Bluehost Inc. |
| jandgpartners.com | j and g partners | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| spiritartiststudios.com | spirit artist studios | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| beacorpholdings.com | beacorp holdings | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| garykelleyfilm.com | gary kelley film | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| medadrealestate.com | medad real estate | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| bigappleinstallers.com | big apple installers | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| readyministry.com | ready ministry | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| activetiles.com | active tiles | 2015-08-03 | 2026-08-03 | 11 | Realtime Register B.V. |
| craigslistking.com | craigslist king | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| feinstarbeit.com | feinst arbeit | 2015-09-14 | 2026-09-14 | 11 | Inwx Gmbh |
| footgolfsock.com | foot golf sock | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| pamplonatodotren.com | pamplona todo tren | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| springfielddirectory.com | springfield directory | 2015-08-05 | 2026-08-05 | 11 | Dynadot |
| beijiatoys.com | beijia toys | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| winburstinternational.com | win burst international | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| harrodandharrod.com | harrod and harrod | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| wsbamadison.com | wsb amadison | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| alexazerrate.com | alexa zerrate | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| gttong.com | gt tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| mediocregamesllc.com | mediocre games llc | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| coronasunsetfestpr.com | corona sunset fest pr | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| wxjwyy.com | wxjwyy | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| vatajrealty.com | vataj realty | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| castleboundenterprises.com | castle bound enterprises | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| vegetable-supplelacb.com | vegetable supplelacb | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| reviewsie.com | reviews ie | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| alldeals2day.com | all deals 2 day | 2015-09-16 | 2026-09-16 | 11 | Key-Systems Gmbh |
| sanqiangcn.com | san qiang cn | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| kyonapparel.com | kyon apparel | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| sidowskimontagen.com | sidowski montagen | 2015-08-03 | 2026-08-03 | 11 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| karnatakaabrasives.com | karnataka abrasives | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| alabamagulfcoastteam.com | alabama gulf coast team | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| fiftyshadesofwtf.com | fifty shades of wtf | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| 0yuanke.com | 0 yuan ke | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| divenfx.com | diven fx | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| ronrinker.com | ron rinker | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| dacalir.com | dacalir | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| frankheljenek.com | frank heljenek | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| dragsak.com | dragsak | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| nbzhhw.com | nbzhhw | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| turtletuesdays.com | turtle tuesdays | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ivantym.com | ivantym | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| udforehosting.com | udfore hosting | 2015-08-03 | 2026-08-03 | 11 | Netistrar Limited |
| emkashop.com | emka shop | 2015-08-03 | 2026-08-03 | 11 | İSimtescil Bilişim A.Ş. |
| immunerescue.com | immune rescue | 2015-08-03 | 2026-08-03 | 11 | Spaceship, Inc. |
| jimberryautosales.com | jim berry auto sales | 2015-07-31 | 2026-07-31 | 11 | Sav.Com, Llc |
| live388.com | live 388 | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| firstpremierpoolandspa.com | first premier pool and spa | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| estudiosiamo.com | estudio siamo | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| renklibalina.com | renkli balina | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| cardloan-senyou.com | card loan senyou | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| yundongnet.com | yun dong net | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| straightpathharvest.com | straight path harvest | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| zimmermanarchitectureinc.com | zimmerman architecture inc | 2017-07-21 | 2028-07-21 | 11 | GoDaddy |
| ridingthelovewave.com | riding the love wave | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| syallkids.com | sy all kids | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| 336318.com | 336318 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| greatplainsdentalassisting.com | great plains dental assisting | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| vertutraveler.com | vertu traveler | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| ztlelec.com | ztl elec | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| rstyledesign.com | r style design | 2015-08-04 | 2026-08-04 | 11 | NameSilo |
| communetraining.com | commune training | 2015-08-02 | 2026-08-02 | 11 | Register.Com – Network Solutions, Llc |
| meinuomei.com | mei nuo mei | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| bigtopterror.com | big top terror | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| shellichambleyrealtor.com | shelli chambley realtor | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| brianlauscher.com | brian lauscher | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| omahabrewbus.com | omaha brew bus | 2015-08-22 | 2026-08-01 | 11 | Domain Science Kutatási Szolgáltató Korlátolt Felelősségű Társaság |
| universalsteeldistributor.com | universal steel distributor | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| sfysp.com | sfysp | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| buscandojale.com | buscando jale | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| hellobowsers.com | hello bowsers | 2015-08-02 | 2026-08-02 | 11 | Ionos Se |
| b2bordercloud.com | b2b order cloud | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ibaycina.com | ibay cina | 2015-08-02 | 2026-08-02 | 11 | Ionos Se |
| palabiyikhukuk.com | palabiyik hukuk | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| kitchenettecooking.com | kitchenette cooking | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| maunakeacmp.com | mauna kea cmp | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| virescentintl.com | virescent intl | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| szjntdz.com | sz jntdz | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| zjhlzm.com | zjhlzm | 2015-08-13 | 2026-08-13 | 11 | Hefei Juming Network Technology Co., Ltd |
| lloyd420.com | lloyd 420 | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| minimise-me.com | minimise me | 2015-08-03 | 2026-08-03 | 11 | Spaceship, Inc. |
| californiapublicsafetypeersupportassociation.com | california public safe typeer support association | 2015-08-03 | 2026-08-03 | 11 | Wild West Domains, Llc |
| tuiuizhuan.com | tui ui zhuan | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| spiritoftiphereth.com | spirit of tiphereth | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| homesinwilliamsburg.com | homes in williamsburg | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| cruisekolkata.com | cruise kolkata | 2015-08-02 | 2026-08-02 | 11 | Name.Com, Inc. |
| thesanctuaryofsemo.com | the sanctuary of semo | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| ppmgbenefits.com | ppmg benefits | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| geniusprogrammers.com | genius programmers | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| payment-online.com | payment online | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| mensulitmateguide.com | men sul it mate guide | 2015-06-09 | 2026-08-03 | 11 | Wild West Domains, Llc |
| pajamaswork.com | pajamas work | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| thepassionarena.com | the passion arena | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ernestojoubert.com | ernesto joubert | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| fontanainfinity.com | fontana infinity | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| toysandheroes.com | toys and heroes | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| wannabelingerie.com | wannabe lingerie | 2015-08-05 | 2026-08-05 | 11 | Onlinenic, Inc. |
| localfriendsf.com | local friend sf | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| behparvaran.com | beh parvaran | 2015-08-05 | 2026-08-05 | 11 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| allproshippingcenter.com | all pro shipping center | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| theprintingshopca.com | the printing shop ca | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| qigochat.com | qigo chat | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| gkfathomchina.com | gk fathom china | 2015-08-04 | 2026-08-04 | 11 | Easydns Technologies Inc. |
| forkliftdpf.com | forklift dpf | 2015-08-07 | 2026-08-07 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| mqcm-china.com | mqcm china | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| jobscupid.com | jobs cupid | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| centerperu.com | center peru | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| jusiboxin.com | ju si bo xin | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| payeefilters.com | payee filters | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| bellaitaliapalacehotel.com | bella italia palace hotel | 2015-08-12 | 2026-08-12 | 11 | Register Spa |
| rusnorth.com | rus north | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| shkp-ifc.com | shkp ifc | 2015-08-05 | 2026-08-05 | 11 | Onlinenic, Inc. |
| emsbusinessdevelopment.com | ems business development | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| esb-innovations.com | esb innovations | 2015-08-02 | 2026-08-02 | 11 | Ionos Se |
| ered-sz.com | ered sz | 2015-08-15 | 2026-08-15 | 11 | Xin Net Technology Corporation |
| calirayorganics.com | caliray organics | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| yesjpsbond.com | yes jps bond | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| alquilardrones.com | alquilar drones | 2015-08-05 | 2026-08-05 | 11 | Dinahosting S.L. |
| alternativejunkie.com | alternative junkie | 2015-03-15 | 2026-08-03 | 11 | GoDaddy |
| leonidellanotte.com | leoni della notte | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| glassbeachmugs.com | glass beach mugs | 2015-08-05 | 2026-08-05 | 11 | Cloudflare, Inc. |
| jpsbondno.com | jps bond no | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| umai-ichi.com | umai ichi | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| afterdarkspot.com | after dark spot | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| alibicustomrods.com | alibi custom rods | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| tognettipropertymaintenance.com | tognetti property maintenance | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| markdanismanlik.com | mark danismanlik | 2015-08-04 | 2026-08-04 | 11 | Ihs Telekom, Inc. |
| edinvestigator.com | ed investigator | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| zbdingtai.com | zb ding tai | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| kprcn.com | kpr cn | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| sidowski.com | sidowski | 2015-08-03 | 2026-08-03 | 11 | Pdr Ltd. D/B/A Publicdomainregistry.Com |
| genreshirt.com | genre shirt | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| oscarglottman.com | oscar glottman | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| nationaldastak.com | national dastak | 2015-08-03 | 2026-08-03 | 11 | Bigrock Solutions Ltd. |
| wellnessworkswithin.com | wellness works within | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| jumpywall.com | jumpy wall | 2015-08-05 | 2026-08-05 | 11 | Hosting Concepts B.V. D/B/A Registrar.Eu |
| halloweenfangs.com | halloween fangs | 2015-08-02 | 2026-08-02 | 11 | 22Net, Inc. |
| edacademic.com | ed academic | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ivotefossilfree.com | i vote fossil free | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| syarala.com | syarala | 2015-08-14 | 2026-08-14 | 11 | Iteasy Inc. |
| xn--pckb2a1bxf0fuas8a7f.com | xn--pckb2a1bxf0fuas8a7f | 2015-08-03 | 2026-08-03 | 11 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| vegangiveaways.com | vegan giveaways | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| exploringprodigies.com | exploring prodigies | 2015-08-04 | 2026-08-04 | 11 | Dynadot |
| 40loghat.com | 40 loghat | 2015-08-05 | 2026-08-05 | 11 | Dynadot |
| xtydq.com | xtydq | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| reelectkimsigmon.com | reelect kim sigmon | 2015-08-01 | 2026-08-01 | 11 | Name.Com, Inc. |
| jstsc.com | jstsc | 2015-08-14 | 2026-08-14 | 11 | Hefei Juming Network Technology Co., Ltd |
| rbjc118.com | rbjc 118 | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| schmartphotography.com | schmart photography | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| writetoshoot.com | write to shoot | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| joohongcabin.com | joohong cabin | 2015-08-03 | 2026-08-03 | 11 | Dotname Korea Corp. |
| ltewimax.com | lte wimax | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| tannguyenco.com | tan nguyen co | 2015-08-15 | 2026-08-15 | 11 | Mat Bao Corporation |
| hydromx-us.com | hydromx us | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| thepantheonstudios.com | the pantheon studios | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| theultimateguidetomalesexualhealth.com | the ultimate guide to male sexual health | 2015-06-25 | 2026-08-03 | 11 | Wild West Domains, Llc |
| fastsaleandclose.com | fast sale and close | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| deeloh.com | deeloh | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| capitalproresources.com | capital pro resources | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| mobile2things.com | mobile 2 things | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| kc5117.com | kc 5117 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| cfjlmh.com | cfjlmh | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| mindenhurstdeepcut.com | mindenhurst deepcut | 2015-09-18 | 2026-09-18 | 11 | Csc Corporate Domains, Inc. |
| qiuqiu123.com | qiu qiu 123 | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| universeecar.com | universe ecar | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| jxly0791.com | jxly 0791 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| digitaldetoxtv.com | digital detox tv | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| cireelinsenmanphotography.com | ciree linsenman photography | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| oclarkephoto.com | o clarke photo | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| thehappyprincebeirut.com | the happy prince beirut | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| georgygeorgiev.com | georgy georgiev | 2015-08-02 | 2026-08-02 | 11 | Domain.Com – Network Solutions, Llc |
| wulangyi.com | wu lang yi | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing Ltd. D/B/A Hichina (Www.Net.Cn) |
| auralocean.com | aural ocean | 2015-08-03 | 2026-08-03 | 11 | Enom, Llc |
| alianzatelecompr.com | alianza telecom pr | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| veraschaefer.com | vera schaefer | 2015-10-23 | 2026-10-23 | 11 | Registrygate Gmbh |
| alianzaprtelecom.com | alianza pr telecom | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| watchcollectorsblog.com | watch collectors blog | 2015-08-02 | 2026-08-02 | 11 | Domain.Com – Network Solutions, Llc |
| doktordobr.com | doktor dobr | 2015-08-06 | 2026-08-06 | 11 | Registrar Of Domain Names Reg.Ru Llc |
| zddkjx.com | zddkjx | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| brightstar-asia.com | bright star asia | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| woodsvineyards.com | woods vineyards | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| pietrogalletti.com | pietro galletti | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| dahexiao.com | da he xiao | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| zywl360.com | zywl 360 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| thaibondall.com | thai bond all | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| shshbyy.com | shshbyy | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| stripteeees.com | stripteeees | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| radiolavozdelcordero.com | radio la voz del cordero | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| funwari-nurse.com | funwari nurse | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| church4u-international.com | church 4u international | 2015-08-04 | 2026-08-04 | 11 | Domeneshop As Dba Domainnameshop.Com |
| emsmerchantdirect.com | ems merchant direct | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| purrpassiveincome.com | purr passive income | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| baldwinhillscommunitynews.com | baldwin hills community news | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| bailaite.com | bai lai te | 2015-08-06 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| reelectsigmon.com | reelect sigmon | 2015-08-01 | 2026-08-01 | 11 | Name.Com, Inc. |
| prolanz.com | pro lanz | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| wiesnerhomes.com | wiesner homes | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| jps-bond.com | jps bond | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| alvistaamerica.com | alvista america | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| donavourd.com | donavourd | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| dnickmedia.com | dnick media | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| bostonautoconsulting.com | boston auto consulting | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| momsdemandactionforgunsense.com | moms demand action for gun sense | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| hbcoopequity.com | hb coop equity | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| 3rdpartyinsidernews.com | 3rd party insider news | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| bjzqqg.com | bjzqqg | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| cakmakdunyasi.com | cakmak dunyasi | 2015-08-02 | 2026-08-02 | 11 | İSimtescil Bilişim A.Ş. |
| globalaegonawards.com | global aegon awards | 2015-09-17 | 2026-09-17 | 11 | Metaregistrar Bv |
| stpaulsalliance.com | st pauls alliance | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| zrtong.com | zr tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| theultimateguidetomenshealth.com | the ultimate guide to mens health | 2015-01-28 | 2026-08-03 | 11 | Wild West Domains, Llc |
| jenniferjizz.com | jennifer jizz | 2015-08-05 | 2026-08-05 | 11 | NameSilo |
| vrawm.com | vrawm | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| skyssh.com | sky ssh | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| nrtong.com | nr tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| netmirchi.com | net mirchi | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| xn--72c0baa6bfr6bsea6gvgrc6c1c.com | xn--72c0baa6bfr6bsea6gvgrc6c1c | 2015-08-03 | 2026-08-03 | 11 | Wild West Domains, Llc |
| gr8tleaders.com | gr8t leaders | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| cloud263.com | cloud 263 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| seekola.com | seek ola | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| retrievance.com | retrievance | 2015-08-02 | 2026-08-02 | 11 | Name.Com, Inc. |
| hpzx88.com | hpzx 88 | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| xn--56-1z8c.com | xn--56-1z8c | 2015-04-15 | 2026-08-06 | 11 | Alibaba Cloud Computing (Beijing) Co., Ltd. |
| watsonvacationrentals.com | watson vacation rentals | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| bakuhankatsudo.com | baku han katsudo | 2015-08-03 | 2026-08-03 | 11 | Gmo Internet Group, Inc. D/B/A Onamae.Com |
| worldwebwriters.com | world web writers | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| chelsealrice.com | chelsea l rice | 2015-08-04 | 2026-08-04 | 11 | GoDaddy |
| bogenjagd.com | bogen jagd | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| contracostacouncil.com | contra costa council | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| davidmichaelpaintings.com | david michael paintings | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| vetandpetjobs.com | vet and pet jobs | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| tk-canada.com | tk canada | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| jzsxmscyedu.com | jzsxmscy edu | 2015-08-14 | 2026-08-14 | 11 | Gname.Com Pte. Ltd. |
| solo5min.com | solo 5 min | 2015-08-03 | 2026-08-03 | 11 | Spaceship, Inc. |
| aser-tek.com | aser tek | 2015-08-05 | 2026-08-05 | 11 | Cloudflare, Inc. |
| medadbh.com | medad bh | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| politictimes.com | politic times | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| yisujiafdc.com | yi su jia fdc | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| newhouselawpllc.com | new house law pllc | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| brickbakeovens.com | brick bake ovens | 2015-08-04 | 2026-08-04 | 11 | Turncommerce, Inc. Dba Namebright.Com |
| ilvalentinonyc.com | il valentino nyc | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| textglass.com | text glass | 2015-08-05 | 2026-08-05 | 11 | Cloudflare, Inc. |
| no2jps.com | no 2 jps | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| spkee.com | spkee | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| theoilboutique.com | the oil boutique | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| cndfurniture.com | cnd furniture | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| saxonburgfineart.com | saxonburg fine art | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| tanzhoufood.com | tanzhou food | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| ppedram.com | ppedram | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| ynpzj.com | ynpzj | 2015-08-01 | 2026-08-01 | 11 | West263 International Limited |
| zxlgroup.com | zxl group | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| gloryshovel.com | glory shovel | 2015-08-15 | 2026-08-15 | 11 | Xin Net Technology Corporation |
| countrylovelasts.com | country love lasts | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| heritage-organic.com | heritage organic | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| thompsonforcongress.com | thompson for congress | 2015-08-03 | 2026-08-03 | 11 | Namecheap |
| victoriagale.com | victoria gale | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| sayyesjps.com | say yes jps | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| churchgoersonline.com | church goers online | 2015-11-04 | 2026-11-04 | 11 | GoDaddy |
| dieteticienneamanda.com | dieteticienne amanda | 2015-08-02 | 2026-08-02 | 11 | Ionos Se |
| ihealthshield.com | i health shield | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| azariasabrina.com | azaria sabrina | 2015-08-04 | 2026-08-04 | 11 | Tucows Domains Inc. |
| zeltagent.com | zelt agent | 2015-12-11 | 2026-12-11 | 11 | Registrygate Gmbh |
| baremetalofseattle.com | bare metal of seattle | 2015-08-03 | 2026-08-03 | 11 | GoDaddy |
| officialmichaelkeith.com | official michael keith | 2015-08-02 | 2026-08-02 | 11 | Network Solutions, Llc |
| qttong.com | qt tong | 2015-08-13 | 2026-08-13 | 11 | Gname.Com Pte. Ltd. |
| onapchinhhang.com | onap chinh hang | 2015-08-05 | 2026-08-05 | 11 | Nhan Hoa Software Company Ltd. |